Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 11123..11766 | Replicon | plasmid pHNAH8161B-4 |
Accession | NZ_CP104608 | ||
Organism | Klebsiella pneumoniae strain AHM8C161BI |
Toxin (Protein)
Gene name | vagD | Uniprot ID | Q84A06 |
Locus tag | N5862_RS30580 | Protein ID | WP_000754566.1 |
Coordinates | 11350..11766 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | N5862_RS30575 | Protein ID | WP_001261276.1 |
Coordinates | 11123..11353 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5862_RS30540 (N5862_30530) | 6242..6511 | + | 270 | WP_000339857.1 | hypothetical protein | - |
N5862_RS30545 (N5862_30535) | 6688..7554 | - | 867 | WP_004118283.1 | replication initiation protein | - |
N5862_RS30550 (N5862_30540) | 8084..8188 | + | 105 | WP_032409716.1 | hypothetical protein | - |
N5862_RS30555 (N5862_30545) | 8317..8574 | + | 258 | WP_000764642.1 | hypothetical protein | - |
N5862_RS30560 (N5862_30550) | 8632..9408 | - | 777 | WP_000015958.1 | site-specific integrase | - |
N5862_RS30565 (N5862_30555) | 9405..10148 | - | 744 | WP_000129823.1 | hypothetical protein | - |
N5862_RS30570 (N5862_30560) | 10199..10549 | - | 351 | WP_000493378.1 | hypothetical protein | - |
N5862_RS30575 (N5862_30565) | 11123..11353 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N5862_RS30580 (N5862_30570) | 11350..11766 | + | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5862_RS30585 (N5862_30575) | 11970..12655 | + | 686 | Protein_14 | IS3-like element ISEc15 family transposase | - |
N5862_RS30590 (N5862_30580) | 13328..14836 | + | 1509 | WP_001189123.1 | group II intron reverse transcriptase/maturase | - |
N5862_RS30595 (N5862_30585) | 14917..15096 | + | 180 | Protein_16 | DDE-type integrase/transposase/recombinase | - |
N5862_RS30600 (N5862_30590) | 15378..16454 | + | 1077 | WP_000227969.1 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aac(6')-Ib-cr / qacE / sul1 | - | 1..36052 | 36052 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T258594 WP_000754566.1 NZ_CP104608:11350-11766 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K1G3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |