Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 110457..111109 Replicon plasmid pHNAH8161B-2
Accession NZ_CP104605
Organism Klebsiella pneumoniae strain AHM8C161BI

Toxin (Protein)


Gene name vagD Uniprot ID A0A8A2Q2K1
Locus tag N5862_RS28335 Protein ID WP_017901321.1
Coordinates 110684..111109 (+) Length 142 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A853H7M9
Locus tag N5862_RS28330 Protein ID WP_001261275.1
Coordinates 110457..110687 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5862_RS28325 (N5862_28315) 107628..110204 + 2577 WP_017901322.1 nuclease domain-containing protein -
N5862_RS28330 (N5862_28320) 110457..110687 + 231 WP_001261275.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5862_RS28335 (N5862_28325) 110684..111109 + 426 WP_017901321.1 type II toxin-antitoxin system VapC family toxin Toxin
N5862_RS28340 (N5862_28330) 111127..112095 + 969 WP_077254762.1 IS5 family transposase -
N5862_RS28345 (N5862_28335) 112154..112690 + 537 Protein_126 integrase core domain-containing protein -
N5862_RS28350 (N5862_28340) 112743..112916 + 174 Protein_127 nuclease -
N5862_RS28355 (N5862_28345) 113103..114659 + 1557 WP_025999314.1 sensor domain-containing diguanylate cyclase -
N5862_RS28360 (N5862_28350) 114751..114978 - 228 Protein_129 IS3 family transposase -
N5862_RS28365 (N5862_28355) 114989..115159 + 171 Protein_130 LysR family transcriptional regulator -
N5862_RS28370 (N5862_28360) 115284..115400 - 117 Protein_131 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB4 / blaDHA-1 / sul1 / blaTEM-1B / mph(A) / qacE / aadA2 / dfrA12 - 1..218818 218818
- flank IS/Tn - - 111127..112095 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15412.91 Da        Isoelectric Point: 7.1364

>T258590 WP_017901321.1 NZ_CP104605:110684-111109 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8707.72 Da        Isoelectric Point: 4.3410

>AT258590 WP_001261275.1 NZ_CP104605:110457-110687 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8A2Q2K1

Antitoxin

Source ID Structure
AlphaFold DB A0A853H7M9

References