Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 54469..55379 | Replicon | plasmid pHNAH8161B-2 |
Accession | NZ_CP104605 | ||
Organism | Klebsiella pneumoniae strain AHM8C161BI |
Toxin (Protein)
Gene name | - | Uniprot ID | R4YBC5 |
Locus tag | N5862_RS28015 | Protein ID | WP_004144067.1 |
Coordinates | 54909..55379 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A6A8PHD0 |
Locus tag | N5862_RS28010 | Protein ID | WP_023287184.1 |
Coordinates | 54469..54912 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5862_RS27990 (N5862_27980) | 49885..50634 | + | 750 | Protein_55 | IS5 family transposase | - |
N5862_RS27995 (N5862_27985) | 50663..51631 | + | 969 | WP_074424072.1 | IS5 family transposase | - |
N5862_RS28000 (N5862_27990) | 51827..53173 | + | 1347 | WP_225517490.1 | ThiF family adenylyltransferase | - |
N5862_RS28005 (N5862_27995) | 53226..54368 | + | 1143 | Protein_58 | translesion error-prone DNA polymerase V subunit UmuC | - |
N5862_RS28010 (N5862_28000) | 54469..54912 | + | 444 | WP_023287184.1 | DUF2384 domain-containing protein | Antitoxin |
N5862_RS28015 (N5862_28005) | 54909..55379 | + | 471 | WP_004144067.1 | RES family NAD+ phosphorylase | Toxin |
N5862_RS28020 (N5862_28010) | 55466..56461 | + | 996 | WP_077254794.1 | IS5 family transposase | - |
N5862_RS28025 (N5862_28015) | 56463..57431 | + | 969 | WP_072096747.1 | IS5 family transposase | - |
N5862_RS28030 (N5862_28020) | 57620..57880 | - | 261 | WP_017901409.1 | hypothetical protein | - |
N5862_RS28035 (N5862_28025) | 58185..59180 | + | 996 | WP_077254794.1 | IS5 family transposase | - |
N5862_RS28040 (N5862_28030) | 59182..60150 | + | 969 | WP_077253478.1 | IS5-like element IS903B family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | qnrB4 / blaDHA-1 / sul1 / blaTEM-1B / mph(A) / qacE / aadA2 / dfrA12 | - | 1..218818 | 218818 | |
- | inside | IScluster/Tn | - | - | 47741..61872 | 14131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17573.83 Da Isoelectric Point: 4.5152
>T258589 WP_004144067.1 NZ_CP104605:54909-55379 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16522.84 Da Isoelectric Point: 10.3013
>AT258589 WP_023287184.1 NZ_CP104605:54469-54912 [Klebsiella pneumoniae]
MKTFSLSSSPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSSPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A384IED8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A8PHD0 |