Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 227597..228119 | Replicon | plasmid pHNAH8161B-1 |
Accession | NZ_CP104604 | ||
Organism | Klebsiella pneumoniae strain AHM8C161BI |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
Locus tag | N5862_RS27300 | Protein ID | WP_004181778.1 |
Coordinates | 227835..228119 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | N5862_RS27295 | Protein ID | WP_004181777.1 |
Coordinates | 227597..227845 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5862_RS27275 (N5862_27265) | 222806..223627 | - | 822 | WP_004181772.1 | hypothetical protein | - |
N5862_RS27280 (N5862_27270) | 223689..224042 | - | 354 | WP_004181774.1 | hypothetical protein | - |
N5862_RS27285 (N5862_27275) | 224187..225173 | - | 987 | WP_025368599.1 | hypothetical protein | - |
N5862_RS27290 (N5862_27280) | 225507..227306 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
N5862_RS27295 (N5862_27285) | 227597..227845 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N5862_RS27300 (N5862_27290) | 227835..228119 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5862_RS27305 (N5862_27295) | 228136..228225 | - | 90 | Protein_243 | IS200/IS605 family transposase | - |
N5862_RS27310 (N5862_27300) | 228271..229497 | + | 1227 | WP_284652934.1 | transposase | - |
N5862_RS27315 (N5862_27305) | 229768..229992 | - | 225 | Protein_245 | transposase | - |
N5862_RS27320 (N5862_27310) | 230071..230499 | - | 429 | WP_284653137.1 | IS200/IS605 family transposase | - |
N5862_RS27325 (N5862_27315) | 230535..231722 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
N5862_RS27330 (N5862_27320) | 231767..232138 | - | 372 | WP_040209644.1 | hypothetical protein | - |
N5862_RS27335 (N5862_27325) | 232135..232479 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sul1 / blaDHA-1 / qnrB4 / armA / msr(E) / mph(E) / aph(3')-Ia / ant(2'')-Ia / blaCTX-M-15 / qnrS1 | - | 1..315605 | 315605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T258588 WP_004181778.1 NZ_CP104604:227835-228119 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |