Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 154289..155040 | Replicon | plasmid pHNAH8161B-1 |
Accession | NZ_CP104604 | ||
Organism | Klebsiella pneumoniae strain AHM8C161BI |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | N5862_RS26895 | Protein ID | WP_014386536.1 |
Coordinates | 154289..154771 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | N5862_RS26900 | Protein ID | WP_004902250.1 |
Coordinates | 154762..155040 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5862_RS26875 (N5862_26865) | 150688..151335 | - | 648 | WP_014386537.1 | EcsC family protein | - |
N5862_RS26880 (N5862_26870) | 151362..152117 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
N5862_RS26885 (N5862_26875) | 152218..152610 | - | 393 | WP_032442757.1 | hypothetical protein | - |
N5862_RS26890 (N5862_26880) | 152715..153254 | - | 540 | WP_004902239.1 | hypothetical protein | - |
N5862_RS26895 (N5862_26885) | 154289..154771 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
N5862_RS26900 (N5862_26890) | 154762..155040 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
N5862_RS26905 (N5862_26895) | 155159..155371 | - | 213 | WP_004902255.1 | hypothetical protein | - |
N5862_RS26910 (N5862_26900) | 155479..155820 | - | 342 | WP_004902257.1 | hypothetical protein | - |
N5862_RS26915 (N5862_26905) | 156740..158038 | - | 1299 | Protein_165 | Tn3-like element Tn3 family transposase | - |
N5862_RS26920 (N5862_26910) | 158106..158810 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
N5862_RS26925 (N5862_26915) | 159004..159390 | + | 387 | WP_063102497.1 | bleomycin binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sul1 / blaDHA-1 / qnrB4 / armA / msr(E) / mph(E) / aph(3')-Ia / ant(2'')-Ia / blaCTX-M-15 / qnrS1 | - | 1..315605 | 315605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T258587 WP_014386536.1 NZ_CP104604:c154771-154289 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |