Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 104004..104647 Replicon plasmid pHNAH8161B-1
Accession NZ_CP104604
Organism Klebsiella pneumoniae strain AHM8C161BI

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag N5862_RS26655 Protein ID WP_080901826.1
Coordinates 104231..104647 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag N5862_RS26650 Protein ID WP_049141429.1
Coordinates 104004..104234 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5862_RS26620 (N5862_26610) 99727..99843 + 117 Protein_106 transposase -
N5862_RS26625 (N5862_26615) 99983..100138 - 156 Protein_107 LysR family transcriptional regulator -
N5862_RS26630 (N5862_26620) 100149..100376 + 228 Protein_108 IS3 family transposase -
N5862_RS26635 (N5862_26625) 100468..102024 - 1557 WP_284653068.1 sensor domain-containing diguanylate cyclase -
N5862_RS26640 (N5862_26630) 102234..102377 - 144 Protein_110 MbeD/MobD family mobilization/exclusion protein -
N5862_RS26645 (N5862_26635) 102599..102907 - 309 WP_256574885.1 hypothetical protein -
N5862_RS26650 (N5862_26640) 104004..104234 + 231 WP_049141429.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5862_RS26655 (N5862_26645) 104231..104647 + 417 WP_080901826.1 type II toxin-antitoxin system VapC family toxin Toxin
N5862_RS26660 (N5862_26650) 104830..106095 - 1266 WP_080901827.1 hypothetical protein -
N5862_RS26665 (N5862_26655) 106390..106821 - 432 WP_240272946.1 transposase -
N5862_RS26670 (N5862_26660) 106833..107411 - 579 WP_240272947.1 transposase -
N5862_RS26675 (N5862_26665) 107449..108780 + 1332 Protein_117 Tn3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / blaDHA-1 / qnrB4 / armA / msr(E) / mph(E) / aph(3')-Ia / ant(2'')-Ia / blaCTX-M-15 / qnrS1 - 1..315605 315605


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14883.25 Da        Isoelectric Point: 7.2449

>T258586 WP_080901826.1 NZ_CP104604:104231-104647 [Klebsiella pneumoniae]
VIKTYMLDTNICSFIMREQPEAVIKRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHGLLVEAFCARLDAILAWDRA
AVDASTEIKAALTAAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWAS

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8667.69 Da        Isoelectric Point: 4.3193

>AT258586 WP_049141429.1 NZ_CP104604:104004-104234 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFTQLENADPDFMAERGDVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References