Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5218811..5219436 | Replicon | chromosome |
| Accession | NZ_CP104603 | ||
| Organism | Klebsiella pneumoniae strain AHM8C161BI | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | N5862_RS25725 | Protein ID | WP_019705794.1 |
| Coordinates | 5218811..5219194 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | N5862_RS25730 | Protein ID | WP_004150355.1 |
| Coordinates | 5219194..5219436 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5862_RS25710 (5216177) | 5216177..5217079 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| N5862_RS25715 (5217076) | 5217076..5217711 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5862_RS25720 (5217708) | 5217708..5218637 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| N5862_RS25725 (5218811) | 5218811..5219194 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5862_RS25730 (5219194) | 5219194..5219436 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| N5862_RS25735 (5219641) | 5219641..5220558 | + | 918 | WP_004146235.1 | alpha/beta hydrolase | - |
| N5862_RS25740 (5220573) | 5220573..5221514 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| N5862_RS25745 (5221559) | 5221559..5221996 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| N5862_RS25750 (5221993) | 5221993..5222853 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| N5862_RS25755 (5222847) | 5222847..5223446 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T258584 WP_019705794.1 NZ_CP104603:c5219194-5218811 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |