Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 74384..74906 Replicon plasmid pHNAH8160R
Accession NZ_CP104600
Organism Escherichia coli strain AHM8C160RI

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag N5861_RS24785 Protein ID WP_000220561.1
Coordinates 74625..74906 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag N5861_RS24780 Protein ID WP_000121743.1
Coordinates 74384..74635 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5861_RS24760 (N5861_24680) 70551..70904 - 354 WP_024129958.1 DNA distortion polypeptide 3 -
N5861_RS24765 (N5861_24685) 71041..71487 - 447 WP_001074384.1 hypothetical protein -
N5861_RS24770 (N5861_24690) 71491..72333 - 843 WP_000435064.1 replication initiation protein -
N5861_RS24775 (N5861_24695) 72354..73193 - 840 WP_024129959.1 replication initiation protein -
N5861_RS24780 (N5861_24700) 74384..74635 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
N5861_RS24785 (N5861_24705) 74625..74906 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5861_RS24790 (N5861_24710) 75145..75237 - 93 Protein_89 IS6 family transposase -
N5861_RS24795 (N5861_24715) 75403..76602 - 1200 WP_000948429.1 IS91 family transposase -
N5861_RS24800 (N5861_24720) 76612..76800 - 189 WP_000957857.1 hypothetical protein -
N5861_RS24805 (N5861_24725) 76920..78350 + 1431 Protein_92 IS4-like element IS50R family transposase -
N5861_RS24810 (N5861_24730) 78379..79173 + 795 WP_000572405.1 aminoglycoside O-phosphotransferase APH(3')-IIa -
N5861_RS24815 (N5861_24735) 79194..79430 + 237 Protein_94 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B / rmtB / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 / aph(3')-IIa / oqxB / oqxA / mph(A) - 1..94780 94780


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T258572 WP_000220561.1 NZ_CP104600:74625-74906 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT258572 WP_000121743.1 NZ_CP104600:74384-74635 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References