Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 8184..8827 | Replicon | plasmid pHNAH8160R |
| Accession | NZ_CP104600 | ||
| Organism | Escherichia coli strain AHM8C160RI | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | N5861_RS24385 | Protein ID | WP_001044768.1 |
| Coordinates | 8184..8600 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | N5861_RS24390 | Protein ID | WP_001261287.1 |
| Coordinates | 8597..8827 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5861_RS24370 (N5861_24300) | 4683..5273 | - | 591 | WP_000194575.1 | hypothetical protein | - |
| N5861_RS24375 (N5861_24305) | 5273..5530 | - | 258 | WP_000343085.1 | hypothetical protein | - |
| N5861_RS24380 (N5861_24310) | 5884..8022 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| N5861_RS24385 (N5861_24315) | 8184..8600 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5861_RS24390 (N5861_24320) | 8597..8827 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N5861_RS24395 (N5861_24325) | 9123..9413 | + | 291 | WP_000111771.1 | hypothetical protein | - |
| N5861_RS24400 (N5861_24330) | 9403..10302 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| N5861_RS24405 (N5861_24335) | 10352..10537 | - | 186 | WP_284632464.1 | hypothetical protein | - |
| N5861_RS24410 (N5861_24340) | 10576..11358 | - | 783 | WP_001300609.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| N5861_RS24415 (N5861_24345) | 11355..12377 | - | 1023 | WP_000255944.1 | IS21-like element IS100 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B / rmtB / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 / aph(3')-IIa / oqxB / oqxA / mph(A) | - | 1..94780 | 94780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T258571 WP_001044768.1 NZ_CP104600:c8600-8184 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |