Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 8184..8827 Replicon plasmid pHNAH8160R
Accession NZ_CP104600
Organism Escherichia coli strain AHM8C160RI

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag N5861_RS24385 Protein ID WP_001044768.1
Coordinates 8184..8600 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag N5861_RS24390 Protein ID WP_001261287.1
Coordinates 8597..8827 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5861_RS24370 (N5861_24300) 4683..5273 - 591 WP_000194575.1 hypothetical protein -
N5861_RS24375 (N5861_24305) 5273..5530 - 258 WP_000343085.1 hypothetical protein -
N5861_RS24380 (N5861_24310) 5884..8022 + 2139 WP_000350638.1 AAA family ATPase -
N5861_RS24385 (N5861_24315) 8184..8600 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
N5861_RS24390 (N5861_24320) 8597..8827 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5861_RS24395 (N5861_24325) 9123..9413 + 291 WP_000111771.1 hypothetical protein -
N5861_RS24400 (N5861_24330) 9403..10302 + 900 WP_000963206.1 nucleotide-binding protein -
N5861_RS24405 (N5861_24335) 10352..10537 - 186 WP_284632464.1 hypothetical protein -
N5861_RS24410 (N5861_24340) 10576..11358 - 783 WP_001300609.1 IS21-like element IS100kyp family helper ATPase IstB -
N5861_RS24415 (N5861_24345) 11355..12377 - 1023 WP_000255944.1 IS21-like element IS100 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B / rmtB / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 / aph(3')-IIa / oqxB / oqxA / mph(A) - 1..94780 94780


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T258571 WP_001044768.1 NZ_CP104600:c8600-8184 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT258571 WP_001261287.1 NZ_CP104600:c8827-8597 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References