Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 4351046..4351846 | Replicon | chromosome |
Accession | NZ_CP104598 | ||
Organism | Escherichia coli strain AHM8C160RI |
Toxin (Protein)
Gene name | ataT | Uniprot ID | U9Y257 |
Locus tag | N5861_RS21045 | Protein ID | WP_000342447.1 |
Coordinates | 4351046..4351573 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | U9Y285 |
Locus tag | N5861_RS21050 | Protein ID | WP_001277109.1 |
Coordinates | 4351580..4351846 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5861_RS21020 (4346121) | 4346121..4346888 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
N5861_RS21025 (4346885) | 4346885..4348162 | - | 1278 | WP_000803782.1 | branched chain amino acid ABC transporter permease LivM | - |
N5861_RS21030 (4348159) | 4348159..4349085 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
N5861_RS21035 (4349133) | 4349133..4350242 | - | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
N5861_RS21040 (4350666) | 4350666..4351049 | + | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
N5861_RS21045 (4351046) | 4351046..4351573 | - | 528 | WP_000342447.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
N5861_RS21050 (4351580) | 4351580..4351846 | - | 267 | WP_001277109.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
N5861_RS21055 (4351996) | 4351996..4353099 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
N5861_RS21060 (4353370) | 4353370..4354224 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
N5861_RS21065 (4354469) | 4354469..4355527 | - | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
N5861_RS21070 (4355520) | 4355520..4356188 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.63 Da Isoelectric Point: 7.0284
>T258566 WP_000342447.1 NZ_CP104598:c4351573-4351046 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LUM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LUN0 |