Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1096746..1097364 | Replicon | chromosome |
Accession | NZ_CP104598 | ||
Organism | Escherichia coli strain AHM8C160RI |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N5861_RS05240 | Protein ID | WP_001291435.1 |
Coordinates | 1096746..1096964 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | N5861_RS05245 | Protein ID | WP_250308268.1 |
Coordinates | 1096990..1097364 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5861_RS05205 (1092035) | 1092035..1092607 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
N5861_RS05210 (1092638) | 1092638..1092949 | - | 312 | WP_000409911.1 | MGMT family protein | - |
N5861_RS05220 (1093328) | 1093328..1093681 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N5861_RS05225 (1093723) | 1093723..1095273 | - | 1551 | WP_024210825.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N5861_RS05230 (1095437) | 1095437..1095907 | - | 471 | WP_033814868.1 | YlaC family protein | - |
N5861_RS05235 (1096023) | 1096023..1096574 | - | 552 | WP_094317739.1 | maltose O-acetyltransferase | - |
N5861_RS05240 (1096746) | 1096746..1096964 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N5861_RS05245 (1096990) | 1096990..1097364 | - | 375 | WP_250308268.1 | Hha toxicity modulator TomB | Antitoxin |
N5861_RS05250 (1097910) | 1097910..1101059 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N5861_RS05255 (1101082) | 1101082..1102275 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258550 WP_001291435.1 NZ_CP104598:c1096964-1096746 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14545.33 Da Isoelectric Point: 4.7395
>AT258550 WP_250308268.1 NZ_CP104598:c1097364-1096990 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKTKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKTKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|