Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 609401..609951 Replicon chromosome
Accession NZ_CP104598
Organism Escherichia coli strain AHM8C160RI

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag N5861_RS02945 Protein ID WP_001160974.1
Coordinates 609637..609951 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag N5861_RS02940 Protein ID WP_000125566.1
Coordinates 609401..609634 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5861_RS02915 (604472) 604472..604759 + 288 WP_000203747.1 ferredoxin-like protein FixX -
N5861_RS02920 (604817) 604817..606148 + 1332 WP_074526432.1 MFS transporter -
N5861_RS02925 (606259) 606259..606789 + 531 WP_000600718.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N5861_RS02930 (606782) 606782..608644 + 1863 WP_284632345.1 glutathione-regulated potassium-efflux system protein KefC -
N5861_RS02935 (608836) 608836..609315 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
N5861_RS02940 (609401) 609401..609634 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N5861_RS02945 (609637) 609637..609951 + 315 WP_001160974.1 CcdB family protein Toxin
N5861_RS02950 (609948) 609948..610796 - 849 WP_069913600.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N5861_RS02955 (610803) 610803..611180 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N5861_RS02960 (611183) 611183..612004 - 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N5861_RS02965 (612001) 612001..612990 - 990 WP_069913599.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N5861_RS02970 (612990) 612990..614276 - 1287 WP_000800453.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T258548 WP_001160974.1 NZ_CP104598:609637-609951 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT258548 WP_000125566.1 NZ_CP104598:609401-609634 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References