Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 444057..444855 Replicon chromosome
Accession NZ_CP104598
Organism Escherichia coli strain AHM8C160RI

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag N5861_RS02140 Protein ID WP_000854919.1
Coordinates 444478..444855 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag N5861_RS02135 Protein ID WP_001285608.1
Coordinates 444057..444431 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5861_RS02100 (439348) 439348..440025 + 678 WP_001097301.1 hypothetical protein -
N5861_RS02105 (440031) 440031..440264 + 234 WP_001278293.1 DUF905 family protein -
N5861_RS02110 (440354) 440354..441172 + 819 WP_250308361.1 DUF932 domain-containing protein -
N5861_RS02120 (442699) 442699..443178 + 480 WP_250308362.1 antirestriction protein -
N5861_RS02125 (443193) 443193..443669 + 477 WP_001186188.1 RadC family protein -
N5861_RS02130 (443756) 443756..443977 + 222 WP_000692350.1 DUF987 domain-containing protein -
N5861_RS02135 (444057) 444057..444431 + 375 WP_001285608.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N5861_RS02140 (444478) 444478..444855 + 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
N5861_RS02145 (444852) 444852..445340 + 489 WP_250308363.1 DUF5983 family protein -
N5861_RS02150 (445360) 445360..445557 + 198 WP_001327226.1 DUF957 domain-containing protein -
N5861_RS02155 (445642) 445642..445785 + 144 Protein_413 hypothetical protein -
N5861_RS02160 (446327) 446327..447325 + 999 WP_001240356.1 membrane protein -
N5861_RS02165 (447436) 447436..448308 - 873 WP_001600928.1 HNH endonuclease -
N5861_RS02170 (448408) 448408..448512 + 105 Protein_416 HNH endonuclease -
N5861_RS02175 (448520) 448520..449500 - 981 WP_000991444.1 sialate O-acetylesterase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - papC / fimB / fimE 417434..454535 37101
- inside Prophage - fimB / fimE 420739..454535 33796


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T258546 WP_000854919.1 NZ_CP104598:444478-444855 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT258546 WP_001285608.1 NZ_CP104598:444057-444431 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References