Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 34446..35089 | Replicon | plasmid pEC9952-1 |
| Accession | NZ_CP104596 | ||
| Organism | Escherichia coli strain EC9952 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | N5B57_RS24025 | Protein ID | WP_001034044.1 |
| Coordinates | 34673..35089 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | N5B57_RS24020 | Protein ID | WP_001261286.1 |
| Coordinates | 34446..34676 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B57_RS24005 (29583) | 29583..29813 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| N5B57_RS24010 (29810) | 29810..30226 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| N5B57_RS24015 (30271) | 30271..34065 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| N5B57_RS24020 (34446) | 34446..34676 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N5B57_RS24025 (34673) | 34673..35089 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5B57_RS24030 (35164) | 35164..36729 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| N5B57_RS24035 (36714) | 36714..37736 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / aph(3')-Ia / sul3 / blaCTX-M-27 / mph(A) / aac(3)-IId / blaTEM-1B | iutA / iucD / iucC / iucB / iucA | 1..157264 | 157264 | |
| - | flank | IS/Tn | - | - | 37990..38493 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T258544 WP_001034044.1 NZ_CP104596:34673-35089 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |