Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 29583..30226 Replicon plasmid pEC9952-1
Accession NZ_CP104596
Organism Escherichia coli strain EC9952

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag N5B57_RS24010 Protein ID WP_001034046.1
Coordinates 29810..30226 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag N5B57_RS24005 Protein ID WP_001261278.1
Coordinates 29583..29813 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5B57_RS23975 (25093) 25093..25398 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
N5B57_RS23980 (25400) 25400..25618 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
N5B57_RS23985 (26210) 26210..26698 + 489 WP_011254646.1 hypothetical protein -
N5B57_RS23990 (26732) 26732..27865 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
N5B57_RS23995 (28032) 28032..28805 - 774 WP_000905949.1 hypothetical protein -
N5B57_RS24000 (28818) 28818..29318 - 501 WP_000528931.1 HEPN family nuclease -
N5B57_RS24005 (29583) 29583..29813 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5B57_RS24010 (29810) 29810..30226 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
N5B57_RS24015 (30271) 30271..34065 - 3795 WP_001144732.1 hypothetical protein -
N5B57_RS24020 (34446) 34446..34676 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
N5B57_RS24025 (34673) 34673..35089 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / aph(3')-Ia / sul3 / blaCTX-M-27 / mph(A) / aac(3)-IId / blaTEM-1B iutA / iucD / iucC / iucB / iucA 1..157264 157264


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T258543 WP_001034046.1 NZ_CP104596:29810-30226 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT258543 WP_001261278.1 NZ_CP104596:29583-29813 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References