Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3919593..3920391 | Replicon | chromosome |
| Accession | NZ_CP104595 | ||
| Organism | Escherichia coli strain EC9952 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VRA6 |
| Locus tag | N5B57_RS19090 | Protein ID | WP_000854730.1 |
| Coordinates | 3920014..3920391 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P0SQV8 |
| Locus tag | N5B57_RS19085 | Protein ID | WP_001285481.1 |
| Coordinates | 3919593..3919967 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B57_RS19045 (3915568) | 3915568..3916020 | + | 453 | WP_000682723.1 | hypothetical protein | - |
| N5B57_RS19050 (3916138) | 3916138..3916371 | + | 234 | WP_001213776.1 | DUF905 family protein | - |
| N5B57_RS19055 (3916471) | 3916471..3917292 | + | 822 | WP_001234359.1 | DUF932 domain-containing protein | - |
| N5B57_RS19060 (3917292) | 3917292..3917537 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| N5B57_RS19065 (3917631) | 3917631..3918104 | + | 474 | WP_001313575.1 | antirestriction protein | - |
| N5B57_RS19070 (3918120) | 3918120..3918596 | + | 477 | WP_001313574.1 | RadC family protein | - |
| N5B57_RS19075 (3918659) | 3918659..3918880 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| N5B57_RS19080 (3918899) | 3918899..3919543 | + | 645 | WP_000086759.1 | hypothetical protein | - |
| N5B57_RS19085 (3919593) | 3919593..3919967 | + | 375 | WP_001285481.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5B57_RS19090 (3920014) | 3920014..3920391 | + | 378 | WP_000854730.1 | TA system toxin CbtA family protein | Toxin |
| N5B57_RS19095 (3920388) | 3920388..3920880 | + | 493 | Protein_3741 | DUF5983 family protein | - |
| N5B57_RS19100 (3920959) | 3920959..3921947 | - | 989 | Protein_3742 | IS630 family transposase | - |
| N5B57_RS19105 (3922095) | 3922095..3923688 | - | 1594 | Protein_3743 | IS66 family transposase | - |
| N5B57_RS19110 (3923719) | 3923719..3924069 | - | 351 | WP_000624707.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| N5B57_RS19115 (3924066) | 3924066..3924357 | - | 292 | Protein_3745 | transposase | - |
| N5B57_RS19120 (3924399) | 3924399..3924593 | + | 195 | WP_001313570.1 | DUF957 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14212.21 Da Isoelectric Point: 7.2923
>T258535 WP_000854730.1 NZ_CP104595:3920014-3920391 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13817.53 Da Isoelectric Point: 4.7511
>AT258535 WP_001285481.1 NZ_CP104595:3919593-3919967 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V671 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P0SQV8 |