Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3919593..3920391 Replicon chromosome
Accession NZ_CP104595
Organism Escherichia coli strain EC9952

Toxin (Protein)


Gene name yeeV Uniprot ID Q8VRA6
Locus tag N5B57_RS19090 Protein ID WP_000854730.1
Coordinates 3920014..3920391 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P0SQV8
Locus tag N5B57_RS19085 Protein ID WP_001285481.1
Coordinates 3919593..3919967 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5B57_RS19045 (3915568) 3915568..3916020 + 453 WP_000682723.1 hypothetical protein -
N5B57_RS19050 (3916138) 3916138..3916371 + 234 WP_001213776.1 DUF905 family protein -
N5B57_RS19055 (3916471) 3916471..3917292 + 822 WP_001234359.1 DUF932 domain-containing protein -
N5B57_RS19060 (3917292) 3917292..3917537 + 246 WP_001164966.1 hypothetical protein -
N5B57_RS19065 (3917631) 3917631..3918104 + 474 WP_001313575.1 antirestriction protein -
N5B57_RS19070 (3918120) 3918120..3918596 + 477 WP_001313574.1 RadC family protein -
N5B57_RS19075 (3918659) 3918659..3918880 + 222 WP_000692315.1 DUF987 domain-containing protein -
N5B57_RS19080 (3918899) 3918899..3919543 + 645 WP_000086759.1 hypothetical protein -
N5B57_RS19085 (3919593) 3919593..3919967 + 375 WP_001285481.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5B57_RS19090 (3920014) 3920014..3920391 + 378 WP_000854730.1 TA system toxin CbtA family protein Toxin
N5B57_RS19095 (3920388) 3920388..3920880 + 493 Protein_3741 DUF5983 family protein -
N5B57_RS19100 (3920959) 3920959..3921947 - 989 Protein_3742 IS630 family transposase -
N5B57_RS19105 (3922095) 3922095..3923688 - 1594 Protein_3743 IS66 family transposase -
N5B57_RS19110 (3923719) 3923719..3924069 - 351 WP_000624707.1 IS66 family insertion sequence element accessory protein TnpB -
N5B57_RS19115 (3924066) 3924066..3924357 - 292 Protein_3745 transposase -
N5B57_RS19120 (3924399) 3924399..3924593 + 195 WP_001313570.1 DUF957 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14212.21 Da        Isoelectric Point: 7.2923

>T258535 WP_000854730.1 NZ_CP104595:3920014-3920391 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13817.53 Da        Isoelectric Point: 4.7511

>AT258535 WP_001285481.1 NZ_CP104595:3919593-3919967 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V671

Antitoxin

Source ID Structure
AlphaFold DB A0A0P0SQV8

References