Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3592913..3593750 | Replicon | chromosome |
| Accession | NZ_CP104595 | ||
| Organism | Escherichia coli strain EC9952 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | - |
| Locus tag | N5B57_RS17540 | Protein ID | WP_063120031.1 |
| Coordinates | 3593208..3593750 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | N5B57_RS17535 | Protein ID | WP_001297137.1 |
| Coordinates | 3592913..3593224 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B57_RS17510 (3587933) | 3587933..3588880 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| N5B57_RS17515 (3588902) | 3588902..3590893 | + | 1992 | WP_094312410.1 | cytochrome o ubiquinol oxidase subunit I | - |
| N5B57_RS17520 (3590883) | 3590883..3591497 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| N5B57_RS17525 (3591497) | 3591497..3591826 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| N5B57_RS17530 (3591838) | 3591838..3592728 | + | 891 | WP_000971336.1 | heme o synthase | - |
| N5B57_RS17535 (3592913) | 3592913..3593224 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| N5B57_RS17540 (3593208) | 3593208..3593750 | + | 543 | WP_063120031.1 | GNAT family N-acetyltransferase | Toxin |
| N5B57_RS17545 (3593806) | 3593806..3594741 | - | 936 | WP_272471720.1 | tetratricopeptide repeat protein | - |
| N5B57_RS17550 (3595148) | 3595148..3596512 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| N5B57_RS17555 (3596640) | 3596640..3597131 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| N5B57_RS17560 (3597299) | 3597299..3598210 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19705.88 Da Isoelectric Point: 8.0330
>T258534 WP_063120031.1 NZ_CP104595:3593208-3593750 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVAGKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVAGKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|