Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2888796..2889597 | Replicon | chromosome |
| Accession | NZ_CP104595 | ||
| Organism | Escherichia coli strain EC9952 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2V687 |
| Locus tag | N5B57_RS14260 | Protein ID | WP_000854739.1 |
| Coordinates | 2888796..2889176 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
| Locus tag | N5B57_RS14265 | Protein ID | WP_001285482.1 |
| Coordinates | 2889223..2889597 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B57_RS14225 (2884387) | 2884387..2884941 | - | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
| N5B57_RS14230 (2884965) | 2884965..2885702 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| N5B57_RS14235 (2885757) | 2885757..2886695 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| N5B57_RS14245 (2887166) | 2887166..2888009 | - | 844 | Protein_2791 | DUF4942 domain-containing protein | - |
| N5B57_RS14250 (2888094) | 2888094..2888291 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| N5B57_RS14255 (2888311) | 2888311..2888799 | - | 489 | WP_001054232.1 | DUF5983 family protein | - |
| N5B57_RS14260 (2888796) | 2888796..2889176 | - | 381 | WP_000854739.1 | TA system toxin CbtA family protein | Toxin |
| N5B57_RS14265 (2889223) | 2889223..2889597 | - | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5B57_RS14270 (2889647) | 2889647..2890291 | - | 645 | WP_000086763.1 | hypothetical protein | - |
| N5B57_RS14275 (2890310) | 2890310..2890531 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| N5B57_RS14280 (2890594) | 2890594..2891070 | - | 477 | WP_001186774.1 | RadC family protein | - |
| N5B57_RS14285 (2891086) | 2891086..2891559 | - | 474 | WP_001542276.1 | antirestriction protein | - |
| N5B57_RS14290 (2891822) | 2891822..2892643 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| N5B57_RS14295 (2892822) | 2892822..2892911 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| N5B57_RS14300 (2893054) | 2893054..2893509 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14214.14 Da Isoelectric Point: 6.4773
>T258532 WP_000854739.1 NZ_CP104595:c2889176-2888796 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT258532 WP_001285482.1 NZ_CP104595:c2889597-2889223 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V687 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7R0L9 |