Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1356596..1357221 | Replicon | chromosome |
| Accession | NZ_CP104595 | ||
| Organism | Escherichia coli strain EC9952 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5B57_RS06640 | Protein ID | WP_000911330.1 |
| Coordinates | 1356823..1357221 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | N5B57_RS06635 | Protein ID | WP_000450524.1 |
| Coordinates | 1356596..1356823 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B57_RS06610 (1352399) | 1352399..1352869 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| N5B57_RS06615 (1352869) | 1352869..1353441 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| N5B57_RS06620 (1353587) | 1353587..1354465 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| N5B57_RS06625 (1354482) | 1354482..1355516 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
| N5B57_RS06630 (1355729) | 1355729..1356442 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| N5B57_RS06635 (1356596) | 1356596..1356823 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N5B57_RS06640 (1356823) | 1356823..1357221 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5B57_RS06645 (1357368) | 1357368..1358231 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| N5B57_RS06650 (1358246) | 1358246..1360261 | + | 2016 | WP_047086710.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| N5B57_RS06655 (1360335) | 1360335..1361033 | + | 699 | WP_000679812.1 | esterase | - |
| N5B57_RS06660 (1361143) | 1361143..1361343 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T258525 WP_000911330.1 NZ_CP104595:1356823-1357221 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|