Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 788089..788887 Replicon chromosome
Accession NZ_CP104595
Organism Escherichia coli strain EC9952

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag N5B57_RS03815 Protein ID WP_000854735.1
Coordinates 788089..788466 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag N5B57_RS03820 Protein ID WP_032153712.1
Coordinates 788513..788887 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5B57_RS03780 (783652) 783652..784830 + 1179 WP_000094971.1 type II secretion system protein GspL -
N5B57_RS03785 (784832) 784832..785368 + 537 WP_000942786.1 GspM family type II secretion system protein YghD -
N5B57_RS03790 (785783) 785783..786109 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5B57_RS03795 (786106) 786106..786369 - 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
N5B57_RS03800 (786441) 786441..787307 - 867 WP_032153714.1 DUF4942 domain-containing protein -
N5B57_RS03805 (787392) 787392..787589 - 198 WP_000839265.1 DUF957 domain-containing protein -
N5B57_RS03810 (787601) 787601..788092 - 492 WP_023155722.1 DUF5983 family protein -
N5B57_RS03815 (788089) 788089..788466 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
N5B57_RS03820 (788513) 788513..788887 - 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N5B57_RS03825 (788967) 788967..789188 - 222 WP_000692345.1 DUF987 domain-containing protein -
N5B57_RS03830 (789257) 789257..789733 - 477 WP_001186715.1 RadC family protein -
N5B57_RS03835 (789749) 789749..790234 - 486 WP_032153711.1 antirestriction protein -
N5B57_RS03840 (790326) 790326..791144 - 819 WP_001234693.1 DUF932 domain-containing protein -
N5B57_RS03845 (791235) 791235..791444 - 210 WP_023155727.1 DUF905 family protein -
N5B57_RS03850 (791474) 791474..792151 - 678 WP_023155728.1 hypothetical protein -
N5B57_RS03855 (792270) 792270..793154 - 885 WP_024166630.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR papI / papB 785783..850928 65145


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T258522 WP_000854735.1 NZ_CP104595:c788466-788089 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT258522 WP_032153712.1 NZ_CP104595:c788887-788513 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References