Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 788089..788887 | Replicon | chromosome |
| Accession | NZ_CP104595 | ||
| Organism | Escherichia coli strain EC9952 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | N5B57_RS03815 | Protein ID | WP_000854735.1 |
| Coordinates | 788089..788466 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1EW42 |
| Locus tag | N5B57_RS03820 | Protein ID | WP_032153712.1 |
| Coordinates | 788513..788887 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B57_RS03780 (783652) | 783652..784830 | + | 1179 | WP_000094971.1 | type II secretion system protein GspL | - |
| N5B57_RS03785 (784832) | 784832..785368 | + | 537 | WP_000942786.1 | GspM family type II secretion system protein YghD | - |
| N5B57_RS03790 (785783) | 785783..786109 | - | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N5B57_RS03795 (786106) | 786106..786369 | - | 264 | WP_025492088.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| N5B57_RS03800 (786441) | 786441..787307 | - | 867 | WP_032153714.1 | DUF4942 domain-containing protein | - |
| N5B57_RS03805 (787392) | 787392..787589 | - | 198 | WP_000839265.1 | DUF957 domain-containing protein | - |
| N5B57_RS03810 (787601) | 787601..788092 | - | 492 | WP_023155722.1 | DUF5983 family protein | - |
| N5B57_RS03815 (788089) | 788089..788466 | - | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| N5B57_RS03820 (788513) | 788513..788887 | - | 375 | WP_032153712.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5B57_RS03825 (788967) | 788967..789188 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| N5B57_RS03830 (789257) | 789257..789733 | - | 477 | WP_001186715.1 | RadC family protein | - |
| N5B57_RS03835 (789749) | 789749..790234 | - | 486 | WP_032153711.1 | antirestriction protein | - |
| N5B57_RS03840 (790326) | 790326..791144 | - | 819 | WP_001234693.1 | DUF932 domain-containing protein | - |
| N5B57_RS03845 (791235) | 791235..791444 | - | 210 | WP_023155727.1 | DUF905 family protein | - |
| N5B57_RS03850 (791474) | 791474..792151 | - | 678 | WP_023155728.1 | hypothetical protein | - |
| N5B57_RS03855 (792270) | 792270..793154 | - | 885 | WP_024166630.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | papI / papB | 785783..850928 | 65145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T258522 WP_000854735.1 NZ_CP104595:c788466-788089 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13697.51 Da Isoelectric Point: 6.6240
>AT258522 WP_032153712.1 NZ_CP104595:c788887-788513 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1EW42 |