Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 418928..419621 | Replicon | plasmid pWTJH36 |
Accession | NZ_CP104591 | ||
Organism | Pseudomonas aeruginosa strain WTJH36 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | N5878_RS35675 | Protein ID | WP_003151133.1 |
Coordinates | 418928..419305 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | N5878_RS35680 | Protein ID | WP_001172026.1 |
Coordinates | 419286..419621 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5878_RS35660 (N5878_35660) | 414583..415164 | + | 582 | WP_260890468.1 | hypothetical protein | - |
N5878_RS35665 (N5878_35665) | 415121..418150 | - | 3030 | WP_010799689.1 | Tn3 family transposase | - |
N5878_RS35670 (N5878_35670) | 418134..418736 | - | 603 | WP_010465829.1 | recombinase family protein | - |
N5878_RS35675 (N5878_35675) | 418928..419305 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5878_RS35680 (N5878_35680) | 419286..419621 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N5878_RS35685 (N5878_35685) | 419636..419971 | + | 336 | WP_000741275.1 | hypothetical protein | - |
N5878_RS35690 (N5878_35690) | 419995..420321 | + | 327 | WP_000091614.1 | hypothetical protein | - |
N5878_RS35695 (N5878_35695) | 420318..420689 | + | 372 | WP_172691856.1 | hypothetical protein | - |
N5878_RS35700 (N5878_35700) | 420784..421206 | + | 423 | WP_260890453.1 | hypothetical protein | - |
N5878_RS35705 (N5878_35705) | 421234..421941 | - | 708 | WP_034036499.1 | hypothetical protein | - |
N5878_RS35710 (N5878_35710) | 422112..422213 | + | 102 | Protein_485 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
N5878_RS35715 (N5878_35715) | 423124..423948 | + | 825 | WP_038405176.1 | Ig-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaVIM-24 / blaOXA-101 / ant(3'')-Ia / qacE / sul1 / aph(3'')-Ib / aph(6)-Id | - | 1..462066 | 462066 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T258519 WP_003151133.1 NZ_CP104591:418928-419305 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |