Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 6926171..6927213 | Replicon | chromosome |
Accession | NZ_CP104590 | ||
Organism | Pseudomonas aeruginosa strain WTJH36 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | N5878_RS32330 | Protein ID | WP_003153636.1 |
Coordinates | 6926638..6927213 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | N5878_RS32325 | Protein ID | WP_003050245.1 |
Coordinates | 6926171..6926641 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5878_RS32290 (N5878_32290) | 6921563..6922981 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
N5878_RS32295 (N5878_32295) | 6922971..6923882 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
N5878_RS32300 (N5878_32300) | 6923879..6924571 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
N5878_RS32305 (N5878_32305) | 6924568..6924966 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
N5878_RS32310 (N5878_32310) | 6924978..6925337 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
N5878_RS32315 (N5878_32315) | 6925354..6925587 | - | 234 | WP_006226027.1 | TIGR03758 family integrating conjugative element protein | - |
N5878_RS32320 (N5878_32320) | 6925584..6925967 | - | 384 | WP_260889984.1 | RAQPRD family integrative conjugative element protein | - |
N5878_RS32325 (N5878_32325) | 6926171..6926641 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
N5878_RS32330 (N5878_32330) | 6926638..6927213 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
N5878_RS32335 (N5878_32335) | 6927231..6928145 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
N5878_RS32340 (N5878_32340) | 6928142..6928612 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
N5878_RS32345 (N5878_32345) | 6928609..6929109 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
N5878_RS32350 (N5878_32350) | 6929109..6930011 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
N5878_RS32355 (N5878_32355) | 6930050..6930775 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 6851596..6973328 | 121732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T258517 WP_003153636.1 NZ_CP104590:6926638-6927213 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT258517 WP_003050245.1 NZ_CP104590:6926171-6926641 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|