Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 4617898..4618403 Replicon chromosome
Accession NZ_CP104590
Organism Pseudomonas aeruginosa strain WTJH36

Toxin (Protein)


Gene name parE Uniprot ID A0A069QL22
Locus tag N5878_RS21510 Protein ID WP_003121619.1
Coordinates 4617898..4618179 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag N5878_RS21515 Protein ID WP_003083775.1
Coordinates 4618176..4618403 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5878_RS21485 (N5878_21485) 4613149..4614498 + 1350 WP_003119513.1 C4-dicarboxylate transporter DctA -
N5878_RS21490 (N5878_21490) 4614547..4615233 + 687 WP_003083762.1 FadR/GntR family transcriptional regulator -
N5878_RS21495 (N5878_21495) 4615334..4616068 + 735 WP_003117208.1 GntR family transcriptional regulator -
N5878_RS21500 (N5878_21500) 4616248..4616658 + 411 WP_003101225.1 aegerolysin family protein -
N5878_RS21505 (N5878_21505) 4616690..4617598 - 909 WP_023083551.1 LysR family transcriptional regulator -
N5878_RS21510 (N5878_21510) 4617898..4618179 - 282 WP_003121619.1 type II toxin-antitoxin system toxin ParE Toxin
N5878_RS21515 (N5878_21515) 4618176..4618403 - 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
N5878_RS21520 (N5878_21520) 4618579..4619199 - 621 WP_003101226.1 hypothetical protein -
N5878_RS21525 (N5878_21525) 4619300..4619800 + 501 WP_003101228.1 LEA type 2 family protein -
N5878_RS21530 (N5878_21530) 4619873..4620214 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
N5878_RS21535 (N5878_21535) 4620296..4621723 - 1428 WP_003083784.1 GABA permease -
N5878_RS21540 (N5878_21540) 4621892..4623385 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10492.22 Da        Isoelectric Point: 10.0435

>T258514 WP_003121619.1 NZ_CP104590:c4618179-4617898 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT258514 WP_003083775.1 NZ_CP104590:c4618403-4618176 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A069QL22

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References