Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2411455..2412095 Replicon chromosome
Accession NZ_CP104590
Organism Pseudomonas aeruginosa strain WTJH36

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N5878_RS11400 Protein ID WP_003134109.1
Coordinates 2411455..2411865 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N5878_RS11405 Protein ID WP_031634724.1
Coordinates 2411865..2412095 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5878_RS11360 (N5878_11360) 2406981..2407778 + 798 WP_235597565.1 hypothetical protein -
N5878_RS11365 (N5878_11365) 2407935..2408663 + 729 WP_004352842.1 TIGR03761 family integrating conjugative element protein -
N5878_RS11370 (N5878_11370) 2408669..2409217 + 549 WP_004352841.1 DUF3158 family protein -
N5878_RS11375 (N5878_11375) 2409264..2410103 + 840 WP_003105750.1 Rha family transcriptional regulator -
N5878_RS11380 (N5878_11380) 2410133..2410621 + 489 WP_004352840.1 single-stranded DNA-binding protein -
N5878_RS11385 (N5878_11385) 2410777..2410944 + 168 WP_128729268.1 CrpP family ICE-associated protein -
N5878_RS11390 (N5878_11390) 2411010..2411228 - 219 WP_023083218.1 hypothetical protein -
N5878_RS11395 (N5878_11395) 2411242..2411439 - 198 WP_023083219.1 hypothetical protein -
N5878_RS11400 (N5878_11400) 2411455..2411865 - 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
N5878_RS11405 (N5878_11405) 2411865..2412095 - 231 WP_031634724.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5878_RS11410 (N5878_11410) 2412351..2414270 + 1920 WP_004352838.1 type I DNA topoisomerase -
N5878_RS11415 (N5878_11415) 2414578..2414787 + 210 WP_003105733.1 cold-shock protein -
N5878_RS11420 (N5878_11420) 2415008..2416897 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2393098..2481941 88843


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-33)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T258512 WP_003134109.1 NZ_CP104590:c2411865-2411455 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8420.29 Da        Isoelectric Point: 4.2821

>AT258512 WP_031634724.1 NZ_CP104590:c2412095-2411865 [Pseudomonas aeruginosa]
VEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References