Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 5605183..5605823 Replicon chromosome
Accession NZ_CP104588
Organism Pseudomonas aeruginosa strain WTJH32

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N5879_RS26125 Protein ID WP_003134109.1
Coordinates 5605183..5605593 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N5879_RS26130 Protein ID WP_031634724.1
Coordinates 5605593..5605823 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5879_RS26085 (N5879_26085) 5600709..5601506 + 798 WP_235597565.1 hypothetical protein -
N5879_RS26090 (N5879_26090) 5601663..5602391 + 729 WP_004352842.1 TIGR03761 family integrating conjugative element protein -
N5879_RS26095 (N5879_26095) 5602397..5602945 + 549 WP_004352841.1 DUF3158 family protein -
N5879_RS26100 (N5879_26100) 5602992..5603831 + 840 WP_003105750.1 Rha family transcriptional regulator -
N5879_RS26105 (N5879_26105) 5603861..5604349 + 489 WP_004352840.1 single-stranded DNA-binding protein -
N5879_RS26110 (N5879_26110) 5604505..5604672 + 168 WP_128729268.1 CrpP family ICE-associated protein -
N5879_RS26115 (N5879_26115) 5604738..5604956 - 219 WP_023083218.1 hypothetical protein -
N5879_RS26120 (N5879_26120) 5604970..5605167 - 198 WP_023083219.1 hypothetical protein -
N5879_RS26125 (N5879_26125) 5605183..5605593 - 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
N5879_RS26130 (N5879_26130) 5605593..5605823 - 231 WP_031634724.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5879_RS26135 (N5879_26135) 5606079..5607998 + 1920 WP_004352838.1 type I DNA topoisomerase -
N5879_RS26140 (N5879_26140) 5608306..5608515 + 210 WP_003105733.1 cold-shock protein -
N5879_RS26145 (N5879_26145) 5608736..5610625 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 5586826..5675669 88843


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-33)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T258508 WP_003134109.1 NZ_CP104588:c5605593-5605183 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8420.29 Da        Isoelectric Point: 4.2821

>AT258508 WP_031634724.1 NZ_CP104588:c5605823-5605593 [Pseudomonas aeruginosa]
VEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References