Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2453078..2454120 | Replicon | chromosome |
Accession | NZ_CP104588 | ||
Organism | Pseudomonas aeruginosa strain WTJH32 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | N5879_RS11440 | Protein ID | WP_003153636.1 |
Coordinates | 2453545..2454120 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | N5879_RS11435 | Protein ID | WP_003050245.1 |
Coordinates | 2453078..2453548 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5879_RS11400 (N5879_11400) | 2448457..2449875 | - | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
N5879_RS11405 (N5879_11405) | 2449865..2450776 | - | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
N5879_RS11410 (N5879_11410) | 2450773..2451465 | - | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
N5879_RS11415 (N5879_11415) | 2451462..2451872 | - | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
N5879_RS11420 (N5879_11420) | 2451885..2452244 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
N5879_RS11425 (N5879_11425) | 2452261..2452494 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
N5879_RS11430 (N5879_11430) | 2452491..2452874 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
N5879_RS11435 (N5879_11435) | 2453078..2453548 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
N5879_RS11440 (N5879_11440) | 2453545..2454120 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
N5879_RS11445 (N5879_11445) | 2454138..2455052 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
N5879_RS11450 (N5879_11450) | 2455049..2455519 | + | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
N5879_RS11455 (N5879_11455) | 2455516..2456016 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
N5879_RS11460 (N5879_11460) | 2456016..2456918 | + | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
N5879_RS11465 (N5879_11465) | 2456957..2457682 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2389706..2500235 | 110529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T258505 WP_003153636.1 NZ_CP104588:2453545-2454120 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT258505 WP_003050245.1 NZ_CP104588:2453078-2453548 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|