Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 151543..152048 Replicon chromosome
Accession NZ_CP104588
Organism Pseudomonas aeruginosa strain WTJH32

Toxin (Protein)


Gene name parE Uniprot ID A0A069QL22
Locus tag N5879_RS00685 Protein ID WP_003121619.1
Coordinates 151543..151824 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag N5879_RS00690 Protein ID WP_003083775.1
Coordinates 151821..152048 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5879_RS00660 (N5879_00660) 146794..148143 + 1350 WP_003119513.1 C4-dicarboxylate transporter DctA -
N5879_RS00665 (N5879_00665) 148192..148878 + 687 WP_003083762.1 FadR/GntR family transcriptional regulator -
N5879_RS00670 (N5879_00670) 148979..149713 + 735 WP_003117208.1 GntR family transcriptional regulator -
N5879_RS00675 (N5879_00675) 149893..150303 + 411 WP_003101225.1 aegerolysin family protein -
N5879_RS00680 (N5879_00680) 150335..151243 - 909 WP_023083551.1 LysR family transcriptional regulator -
N5879_RS00685 (N5879_00685) 151543..151824 - 282 WP_003121619.1 type II toxin-antitoxin system toxin ParE Toxin
N5879_RS00690 (N5879_00690) 151821..152048 - 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
N5879_RS00695 (N5879_00695) 152224..152844 - 621 WP_003101226.1 hypothetical protein -
N5879_RS00700 (N5879_00700) 152945..153445 + 501 WP_003101228.1 LEA type 2 family protein -
N5879_RS00705 (N5879_00705) 153518..153859 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
N5879_RS00710 (N5879_00710) 153941..155368 - 1428 WP_003083784.1 GABA permease -
N5879_RS00715 (N5879_00715) 155537..157030 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10492.22 Da        Isoelectric Point: 10.0435

>T258502 WP_003121619.1 NZ_CP104588:c151824-151543 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT258502 WP_003083775.1 NZ_CP104588:c152048-151821 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A069QL22

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References