Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 386443..387136 | Replicon | plasmid pWTJH6 |
Accession | NZ_CP104587 | ||
Organism | Pseudomonas aeruginosa strain WTJH6 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | N5877_RS33795 | Protein ID | WP_003151133.1 |
Coordinates | 386759..387136 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | N5877_RS33790 | Protein ID | WP_001172026.1 |
Coordinates | 386443..386778 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5877_RS33755 (N5877_33760) | 382116..382940 | - | 825 | WP_038405176.1 | Ig-like domain-containing protein | - |
N5877_RS33760 (N5877_33765) | 383851..383952 | - | 102 | Protein_432 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
N5877_RS33765 (N5877_33770) | 384123..384830 | + | 708 | WP_034036499.1 | hypothetical protein | - |
N5877_RS33770 (N5877_33775) | 384858..385280 | - | 423 | WP_260890453.1 | hypothetical protein | - |
N5877_RS33775 (N5877_33780) | 385375..385746 | - | 372 | WP_172691856.1 | hypothetical protein | - |
N5877_RS33780 (N5877_33785) | 385743..386069 | - | 327 | WP_000091614.1 | hypothetical protein | - |
N5877_RS33785 (N5877_33790) | 386093..386428 | - | 336 | WP_000741275.1 | hypothetical protein | - |
N5877_RS33790 (N5877_33795) | 386443..386778 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N5877_RS33795 (N5877_33800) | 386759..387136 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5877_RS33800 (N5877_33805) | 387328..387930 | + | 603 | WP_010465829.1 | recombinase family protein | - |
N5877_RS33805 (N5877_33810) | 387914..390943 | + | 3030 | WP_010799689.1 | Tn3 family transposase | - |
N5877_RS33810 (N5877_33815) | 390900..391481 | - | 582 | WP_260890468.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib / sul1 / qacE / ant(3'')-Ia / blaOXA-101 / blaVIM-24 | - | 1..426499 | 426499 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T258501 WP_003151133.1 NZ_CP104587:c387136-386759 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |