Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4827136..4827744 | Replicon | chromosome |
Accession | NZ_CP104586 | ||
Organism | Pseudomonas aeruginosa strain WTJH6 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | N5877_RS22330 | Protein ID | WP_016263850.1 |
Coordinates | 4827397..4827744 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | N5877_RS22325 | Protein ID | WP_003114155.1 |
Coordinates | 4827136..4827387 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5877_RS22305 (N5877_22305) | 4822774..4823124 | + | 351 | WP_019725830.1 | DUF2523 family protein | - |
N5877_RS22310 (N5877_22310) | 4823126..4824388 | + | 1263 | WP_019725831.1 | zonular occludens toxin domain-containing protein | - |
N5877_RS22315 (N5877_22315) | 4824647..4825939 | + | 1293 | WP_003115206.1 | hypothetical protein | - |
N5877_RS22320 (N5877_22320) | 4825939..4826922 | + | 984 | WP_124166874.1 | tyrosine-type recombinase/integrase | - |
N5877_RS22325 (N5877_22325) | 4827136..4827387 | + | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N5877_RS22330 (N5877_22330) | 4827397..4827744 | + | 348 | WP_016263850.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5877_RS22340 (N5877_22340) | 4828071..4828973 | - | 903 | WP_003123042.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
N5877_RS22345 (N5877_22345) | 4829425..4830162 | - | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
N5877_RS22350 (N5877_22350) | 4830242..4831285 | - | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
N5877_RS22355 (N5877_22355) | 4831421..4832113 | - | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
N5877_RS22360 (N5877_22360) | 4832113..4832385 | - | 273 | WP_019725834.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4813210..4827744 | 14534 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13046.85 Da Isoelectric Point: 4.4212
>T258496 WP_016263850.1 NZ_CP104586:4827397-4827744 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|