Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4439963..4440603 | Replicon | chromosome |
| Accession | NZ_CP104586 | ||
| Organism | Pseudomonas aeruginosa strain WTJH6 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5877_RS20515 | Protein ID | WP_003134109.1 |
| Coordinates | 4440193..4440603 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N5877_RS20510 | Protein ID | WP_031634724.1 |
| Coordinates | 4439963..4440193 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5877_RS20495 (N5877_20495) | 4435161..4437050 | - | 1890 | WP_003105732.1 | hypothetical protein | - |
| N5877_RS20500 (N5877_20500) | 4437271..4437480 | - | 210 | WP_003105733.1 | cold-shock protein | - |
| N5877_RS20505 (N5877_20505) | 4437788..4439707 | - | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| N5877_RS20510 (N5877_20510) | 4439963..4440193 | + | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N5877_RS20515 (N5877_20515) | 4440193..4440603 | + | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| N5877_RS20520 (N5877_20520) | 4440619..4440816 | + | 198 | WP_023083219.1 | hypothetical protein | - |
| N5877_RS20525 (N5877_20525) | 4440830..4441048 | + | 219 | WP_023083218.1 | hypothetical protein | - |
| N5877_RS20530 (N5877_20530) | 4441114..4441281 | - | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
| N5877_RS20535 (N5877_20535) | 4441437..4441925 | - | 489 | WP_004352840.1 | single-stranded DNA-binding protein | - |
| N5877_RS20540 (N5877_20540) | 4441955..4442794 | - | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
| N5877_RS20545 (N5877_20545) | 4442841..4443389 | - | 549 | WP_004352841.1 | DUF3158 family protein | - |
| N5877_RS20550 (N5877_20550) | 4443395..4444123 | - | 729 | WP_004352842.1 | TIGR03761 family integrating conjugative element protein | - |
| N5877_RS20555 (N5877_20555) | 4444280..4445077 | - | 798 | WP_235597565.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 4371293..4458960 | 87667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T258495 WP_003134109.1 NZ_CP104586:4440193-4440603 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|