Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 4439963..4440603 Replicon chromosome
Accession NZ_CP104586
Organism Pseudomonas aeruginosa strain WTJH6

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N5877_RS20515 Protein ID WP_003134109.1
Coordinates 4440193..4440603 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N5877_RS20510 Protein ID WP_031634724.1
Coordinates 4439963..4440193 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5877_RS20495 (N5877_20495) 4435161..4437050 - 1890 WP_003105732.1 hypothetical protein -
N5877_RS20500 (N5877_20500) 4437271..4437480 - 210 WP_003105733.1 cold-shock protein -
N5877_RS20505 (N5877_20505) 4437788..4439707 - 1920 WP_004352838.1 type I DNA topoisomerase -
N5877_RS20510 (N5877_20510) 4439963..4440193 + 231 WP_031634724.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5877_RS20515 (N5877_20515) 4440193..4440603 + 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
N5877_RS20520 (N5877_20520) 4440619..4440816 + 198 WP_023083219.1 hypothetical protein -
N5877_RS20525 (N5877_20525) 4440830..4441048 + 219 WP_023083218.1 hypothetical protein -
N5877_RS20530 (N5877_20530) 4441114..4441281 - 168 WP_128729268.1 CrpP family ICE-associated protein -
N5877_RS20535 (N5877_20535) 4441437..4441925 - 489 WP_004352840.1 single-stranded DNA-binding protein -
N5877_RS20540 (N5877_20540) 4441955..4442794 - 840 WP_003105750.1 Rha family transcriptional regulator -
N5877_RS20545 (N5877_20545) 4442841..4443389 - 549 WP_004352841.1 DUF3158 family protein -
N5877_RS20550 (N5877_20550) 4443395..4444123 - 729 WP_004352842.1 TIGR03761 family integrating conjugative element protein -
N5877_RS20555 (N5877_20555) 4444280..4445077 - 798 WP_235597565.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 4371293..4458960 87667


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-33)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T258495 WP_003134109.1 NZ_CP104586:4440193-4440603 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8420.29 Da        Isoelectric Point: 4.2821

>AT258495 WP_031634724.1 NZ_CP104586:4439963-4440193 [Pseudomonas aeruginosa]
VEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References