Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 3016647..3017152 | Replicon | chromosome |
| Accession | NZ_CP104586 | ||
| Organism | Pseudomonas aeruginosa strain WTJH6 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | N5877_RS13980 | Protein ID | WP_003083773.1 |
| Coordinates | 3016871..3017152 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | N5877_RS13975 | Protein ID | WP_003083775.1 |
| Coordinates | 3016647..3016874 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5877_RS13950 (N5877_13950) | 3011665..3013158 | + | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| N5877_RS13955 (N5877_13955) | 3013327..3014754 | + | 1428 | WP_003083784.1 | GABA permease | - |
| N5877_RS13960 (N5877_13960) | 3014836..3015177 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| N5877_RS13965 (N5877_13965) | 3015250..3015750 | - | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| N5877_RS13970 (N5877_13970) | 3015851..3016471 | + | 621 | WP_009314940.1 | hypothetical protein | - |
| N5877_RS13975 (N5877_13975) | 3016647..3016874 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| N5877_RS13980 (N5877_13980) | 3016871..3017152 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| N5877_RS13985 (N5877_13985) | 3017452..3018360 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| N5877_RS13990 (N5877_13990) | 3018392..3018802 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
| N5877_RS13995 (N5877_13995) | 3018982..3019716 | - | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| N5877_RS14000 (N5877_14000) | 3019817..3020503 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| N5877_RS14005 (N5877_14005) | 3020552..3021901 | - | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T258493 WP_003083773.1 NZ_CP104586:3016871-3017152 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|