Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 5611627..5612267 | Replicon | chromosome |
| Accession | NZ_CP104584 | ||
| Organism | Pseudomonas aeruginosa strain WTJH2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5876_RS26175 | Protein ID | WP_003134109.1 |
| Coordinates | 5611627..5612037 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N5876_RS26180 | Protein ID | WP_031634724.1 |
| Coordinates | 5612037..5612267 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5876_RS26135 (N5876_26135) | 5607153..5607950 | + | 798 | WP_235597565.1 | hypothetical protein | - |
| N5876_RS26140 (N5876_26140) | 5608107..5608835 | + | 729 | WP_004352842.1 | TIGR03761 family integrating conjugative element protein | - |
| N5876_RS26145 (N5876_26145) | 5608841..5609389 | + | 549 | WP_004352841.1 | DUF3158 family protein | - |
| N5876_RS26150 (N5876_26150) | 5609436..5610275 | + | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
| N5876_RS26155 (N5876_26155) | 5610305..5610793 | + | 489 | WP_004352840.1 | single-stranded DNA-binding protein | - |
| N5876_RS26160 (N5876_26160) | 5610949..5611116 | + | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
| N5876_RS26165 (N5876_26165) | 5611182..5611400 | - | 219 | WP_023083218.1 | hypothetical protein | - |
| N5876_RS26170 (N5876_26170) | 5611414..5611611 | - | 198 | WP_023083219.1 | hypothetical protein | - |
| N5876_RS26175 (N5876_26175) | 5611627..5612037 | - | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| N5876_RS26180 (N5876_26180) | 5612037..5612267 | - | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N5876_RS26185 (N5876_26185) | 5612523..5614442 | + | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| N5876_RS26190 (N5876_26190) | 5614750..5614959 | + | 210 | WP_003105733.1 | cold-shock protein | - |
| N5876_RS26195 (N5876_26195) | 5615180..5617069 | + | 1890 | WP_003105732.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5593270..5682113 | 88843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T258490 WP_003134109.1 NZ_CP104584:c5612037-5611627 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|