Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 5611627..5612267 Replicon chromosome
Accession NZ_CP104584
Organism Pseudomonas aeruginosa strain WTJH2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N5876_RS26175 Protein ID WP_003134109.1
Coordinates 5611627..5612037 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N5876_RS26180 Protein ID WP_031634724.1
Coordinates 5612037..5612267 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5876_RS26135 (N5876_26135) 5607153..5607950 + 798 WP_235597565.1 hypothetical protein -
N5876_RS26140 (N5876_26140) 5608107..5608835 + 729 WP_004352842.1 TIGR03761 family integrating conjugative element protein -
N5876_RS26145 (N5876_26145) 5608841..5609389 + 549 WP_004352841.1 DUF3158 family protein -
N5876_RS26150 (N5876_26150) 5609436..5610275 + 840 WP_003105750.1 Rha family transcriptional regulator -
N5876_RS26155 (N5876_26155) 5610305..5610793 + 489 WP_004352840.1 single-stranded DNA-binding protein -
N5876_RS26160 (N5876_26160) 5610949..5611116 + 168 WP_128729268.1 CrpP family ICE-associated protein -
N5876_RS26165 (N5876_26165) 5611182..5611400 - 219 WP_023083218.1 hypothetical protein -
N5876_RS26170 (N5876_26170) 5611414..5611611 - 198 WP_023083219.1 hypothetical protein -
N5876_RS26175 (N5876_26175) 5611627..5612037 - 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
N5876_RS26180 (N5876_26180) 5612037..5612267 - 231 WP_031634724.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5876_RS26185 (N5876_26185) 5612523..5614442 + 1920 WP_004352838.1 type I DNA topoisomerase -
N5876_RS26190 (N5876_26190) 5614750..5614959 + 210 WP_003105733.1 cold-shock protein -
N5876_RS26195 (N5876_26195) 5615180..5617069 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 5593270..5682113 88843


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-33)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T258490 WP_003134109.1 NZ_CP104584:c5612037-5611627 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8420.29 Da        Isoelectric Point: 4.2821

>AT258490 WP_031634724.1 NZ_CP104584:c5612267-5612037 [Pseudomonas aeruginosa]
VEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References