Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 2453073..2454115 | Replicon | chromosome |
| Accession | NZ_CP104584 | ||
| Organism | Pseudomonas aeruginosa strain WTJH2 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | N5876_RS11440 | Protein ID | WP_003153636.1 |
| Coordinates | 2453540..2454115 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | N5876_RS11435 | Protein ID | WP_003050245.1 |
| Coordinates | 2453073..2453543 (+) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5876_RS11400 (N5876_11400) | 2448452..2449870 | - | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
| N5876_RS11405 (N5876_11405) | 2449860..2450771 | - | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
| N5876_RS11410 (N5876_11410) | 2450768..2451460 | - | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
| N5876_RS11415 (N5876_11415) | 2451457..2451867 | - | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
| N5876_RS11420 (N5876_11420) | 2451880..2452239 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| N5876_RS11425 (N5876_11425) | 2452256..2452489 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
| N5876_RS11430 (N5876_11430) | 2452486..2452869 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| N5876_RS11435 (N5876_11435) | 2453073..2453543 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N5876_RS11440 (N5876_11440) | 2453540..2454115 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| N5876_RS11445 (N5876_11445) | 2454133..2455047 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
| N5876_RS11450 (N5876_11450) | 2455044..2455514 | + | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| N5876_RS11455 (N5876_11455) | 2455511..2456011 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| N5876_RS11460 (N5876_11460) | 2456011..2456913 | + | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
| N5876_RS11465 (N5876_11465) | 2456952..2457677 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2389701..2500230 | 110529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T258487 WP_003153636.1 NZ_CP104584:2453540-2454115 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT258487 WP_003050245.1 NZ_CP104584:2453073-2453543 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|