Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 151549..152054 | Replicon | chromosome |
Accession | NZ_CP104584 | ||
Organism | Pseudomonas aeruginosa strain WTJH2 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | N5876_RS00685 | Protein ID | WP_003121619.1 |
Coordinates | 151549..151830 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | N5876_RS00690 | Protein ID | WP_003083775.1 |
Coordinates | 151827..152054 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5876_RS00660 (N5876_00660) | 146800..148149 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
N5876_RS00665 (N5876_00665) | 148198..148884 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
N5876_RS00670 (N5876_00670) | 148985..149719 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
N5876_RS00675 (N5876_00675) | 149899..150309 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
N5876_RS00680 (N5876_00680) | 150341..151249 | - | 909 | WP_023083551.1 | LysR family transcriptional regulator | - |
N5876_RS00685 (N5876_00685) | 151549..151830 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
N5876_RS00690 (N5876_00690) | 151827..152054 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
N5876_RS00695 (N5876_00695) | 152230..152850 | - | 621 | WP_003101226.1 | hypothetical protein | - |
N5876_RS00700 (N5876_00700) | 152951..153451 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
N5876_RS00705 (N5876_00705) | 153524..153865 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
N5876_RS00710 (N5876_00710) | 153947..155374 | - | 1428 | WP_003083784.1 | GABA permease | - |
N5876_RS00715 (N5876_00715) | 155543..157036 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T258484 WP_003121619.1 NZ_CP104584:c151830-151549 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C7BDS9 |