Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelE-RHH |
Location | 441345..441913 | Replicon | chromosome |
Accession | NZ_CP104583 | ||
Organism | Pseudomonas sp. GD03721 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | N5O88_RS02060 | Protein ID | WP_279531965.1 |
Coordinates | 441345..441626 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | N5O88_RS02065 | Protein ID | WP_279531966.1 |
Coordinates | 441623..441913 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O88_RS02045 (N5O88_02045) | 437039..437203 | - | 165 | Protein_406 | alpha/beta hydrolase | - |
N5O88_RS02050 (N5O88_02050) | 437205..438113 | + | 909 | Protein_407 | IS5-like element ISPa8 family transposase | - |
N5O88_RS02055 (N5O88_02055) | 438685..441342 | + | 2658 | WP_279531964.1 | CRISPR-associated helicase Cas3' | - |
N5O88_RS02060 (N5O88_02060) | 441345..441626 | - | 282 | WP_279531965.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O88_RS02065 (N5O88_02065) | 441623..441913 | - | 291 | WP_279531966.1 | hypothetical protein | Antitoxin |
N5O88_RS02070 (N5O88_02070) | 442122..443663 | + | 1542 | WP_279531967.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
N5O88_RS02075 (N5O88_02075) | 443660..444202 | + | 543 | WP_147810785.1 | type I-E CRISPR-associated protein Cse2/CasB | - |
N5O88_RS02080 (N5O88_02080) | 444213..445355 | + | 1143 | WP_279531968.1 | type I-E CRISPR-associated protein Cas7/Cse4/CasC | - |
N5O88_RS02085 (N5O88_02085) | 445358..446020 | + | 663 | WP_279531969.1 | type I-E CRISPR-associated protein Cas5/CasD | - |
N5O88_RS02090 (N5O88_02090) | 445995..446609 | + | 615 | WP_279531970.1 | type I-E CRISPR-associated protein Cas6/Cse3/CasE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | pilT / pilU | 271008..503698 | 232690 | |
- | flank | IS/Tn | - | - | 437208..438113 | 905 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10522.05 Da Isoelectric Point: 9.6952
>T258478 WP_279531965.1 NZ_CP104583:c441626-441345 [Pseudomonas sp. GD03721]
VKLAWTRLALNDRQAIRSYIAQDNPIAALALDELFAEKAGRLADHPGLGRPGRVNGTRELVVHQHYLMIYDLANDQVRIL
RVLHTARQWPSAD
VKLAWTRLALNDRQAIRSYIAQDNPIAALALDELFAEKAGRLADHPGLGRPGRVNGTRELVVHQHYLMIYDLANDQVRIL
RVLHTARQWPSAD
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|