Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-stbD/ParE-DnaT |
Location | 18966..19533 | Replicon | chromosome |
Accession | NZ_CP104583 | ||
Organism | Pseudomonas sp. GD03721 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N5O88_RS00090 | Protein ID | WP_147811202.1 |
Coordinates | 19237..19533 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | - |
Locus tag | N5O88_RS00085 | Protein ID | WP_177326260.1 |
Coordinates | 18966..19244 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O88_RS00065 (N5O88_00065) | 14389..14919 | - | 531 | WP_279531704.1 | D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase | - |
N5O88_RS00070 (N5O88_00070) | 14977..17031 | - | 2055 | WP_279531705.1 | glycine--tRNA ligase subunit beta | - |
N5O88_RS00075 (N5O88_00075) | 17028..18020 | - | 993 | WP_064493650.1 | glycine--tRNA ligase subunit alpha | - |
N5O88_RS00080 (N5O88_00080) | 18193..18747 | + | 555 | WP_143509751.1 | DNA-3-methyladenine glycosylase I | - |
N5O88_RS00085 (N5O88_00085) | 18966..19244 | + | 279 | WP_177326260.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N5O88_RS00090 (N5O88_00090) | 19237..19533 | + | 297 | WP_147811202.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O88_RS00095 (N5O88_00095) | 19851..20738 | + | 888 | WP_278618339.1 | lysophospholipid acyltransferase | - |
N5O88_RS00100 (N5O88_00100) | 21200..22540 | + | 1341 | WP_279533131.1 | group II intron reverse transcriptase/maturase | - |
N5O88_RS00105 (N5O88_00105) | 22700..22966 | + | 267 | WP_279531706.1 | PilZ domain-containing protein | - |
N5O88_RS00110 (N5O88_00110) | 22992..23234 | - | 243 | Protein_21 | IS5/IS1182 family transposase | - |
N5O88_RS00115 (N5O88_00115) | 23410..24483 | + | 1074 | Protein_22 | AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11440.46 Da Isoelectric Point: 10.5810
>T258477 WP_147811202.1 NZ_CP104583:19237-19533 [Pseudomonas sp. GD03721]
VPSFKLEFHVKARKEWDKLDATIRLQFAKKLKERLSSPRIEADKLSGMVDCYKIKLRSAGYRLVYQVVDDKLVITVVAVG
KRERFEAYIAAQKRVQQQ
VPSFKLEFHVKARKEWDKLDATIRLQFAKKLKERLSSPRIEADKLSGMVDCYKIKLRSAGYRLVYQVVDDKLVITVVAVG
KRERFEAYIAAQKRVQQQ
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|