Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2560193..2560902 | Replicon | chromosome |
Accession | NZ_CP104581 | ||
Organism | Delftia tsuruhatensis strain GD03927 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N5O86_RS11565 | Protein ID | WP_016453265.1 |
Coordinates | 2560193..2560639 (-) | Length | 149 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1D8IU58 |
Locus tag | N5O86_RS11570 | Protein ID | WP_016453264.1 |
Coordinates | 2560636..2560902 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O86_RS11545 (N5O86_11565) | 2555791..2557005 | + | 1215 | WP_279494992.1 | ABC transporter permease | - |
N5O86_RS11550 (N5O86_11570) | 2557007..2558152 | + | 1146 | WP_279494994.1 | ABC transporter permease | - |
N5O86_RS11555 (N5O86_11575) | 2558216..2558845 | - | 630 | WP_279494996.1 | DUF4124 domain-containing protein | - |
N5O86_RS11560 (N5O86_11580) | 2558924..2560129 | - | 1206 | WP_016448243.1 | MFS transporter | - |
N5O86_RS11565 (N5O86_11585) | 2560193..2560639 | - | 447 | WP_016453265.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5O86_RS11570 (N5O86_11590) | 2560636..2560902 | - | 267 | WP_016453264.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N5O86_RS11575 (N5O86_11595) | 2560927..2561898 | - | 972 | WP_046988493.1 | LysR family transcriptional regulator | - |
N5O86_RS11580 (N5O86_11600) | 2561975..2562859 | + | 885 | WP_279494998.1 | amidohydrolase family protein | - |
N5O86_RS11585 (N5O86_11605) | 2562886..2563881 | + | 996 | WP_016448238.1 | tripartite tricarboxylate transporter substrate binding protein | - |
N5O86_RS11590 (N5O86_11610) | 2563905..2565536 | - | 1632 | WP_016448237.1 | gamma-glutamyltransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15880.46 Da Isoelectric Point: 8.1045
>T258465 WP_016453265.1 NZ_CP104581:c2560639-2560193 [Delftia tsuruhatensis]
MTRYLLDTNIASHIIKGDIPAVREQLVRVPMHQIAVSAVTQAELMYGVAKRGHPAGLSLRVTGFLARVEVLPWTAQVADA
YGHLRAACEATGITLASMDMMIAAHALLLQQQAAQAGERSVLVTRDRVFSRIPEPGLAIADWTTGPAG
MTRYLLDTNIASHIIKGDIPAVREQLVRVPMHQIAVSAVTQAELMYGVAKRGHPAGLSLRVTGFLARVEVLPWTAQVADA
YGHLRAACEATGITLASMDMMIAAHALLLQQQAAQAGERSVLVTRDRVFSRIPEPGLAIADWTTGPAG
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|