Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/- |
Location | 918396..918976 | Replicon | chromosome |
Accession | NZ_CP104581 | ||
Organism | Delftia tsuruhatensis strain GD03927 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A072T5F9 |
Locus tag | N5O86_RS04140 | Protein ID | WP_016448367.1 |
Coordinates | 918396..918776 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A072THC0 |
Locus tag | N5O86_RS04145 | Protein ID | WP_016448366.1 |
Coordinates | 918773..918976 (-) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O86_RS04120 (N5O86_04120) | 913707..914948 | + | 1242 | WP_016448371.1 | ABC transporter substrate-binding protein | - |
N5O86_RS04125 (N5O86_04125) | 914945..915703 | + | 759 | WP_026062833.1 | ABC transporter permease | - |
N5O86_RS04130 (N5O86_04130) | 915750..917336 | - | 1587 | WP_279494191.1 | Ig-like domain repeat protein | - |
N5O86_RS04135 (N5O86_04135) | 917566..918318 | + | 753 | WP_234640264.1 | helix-turn-helix transcriptional regulator | - |
N5O86_RS04140 (N5O86_04140) | 918396..918776 | - | 381 | WP_016448367.1 | PIN domain-containing protein | Toxin |
N5O86_RS04145 (N5O86_04145) | 918773..918976 | - | 204 | WP_016448366.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N5O86_RS04150 (N5O86_04150) | 919127..919939 | + | 813 | WP_083393616.1 | glucose 1-dehydrogenase | - |
N5O86_RS04155 (N5O86_04155) | 920049..921722 | + | 1674 | WP_279494195.1 | VRR-NUC domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13790.24 Da Isoelectric Point: 8.3155
>T258464 WP_016448367.1 NZ_CP104581:c918776-918396 [Delftia tsuruhatensis]
MNPVLVDTSVWIDHFRQGNPHLAQLLQQDMALMHPLVLGELACGTPPARARTLADLQRLKPARQASMREVLALIEREQLF
GLGCGLVDITLLASALMSSGASLWSLDKRLHALAQRFGIACRSVLP
MNPVLVDTSVWIDHFRQGNPHLAQLLQQDMALMHPLVLGELACGTPPARARTLADLQRLKPARQASMREVLALIEREQLF
GLGCGLVDITLLASALMSSGASLWSLDKRLHALAQRFGIACRSVLP
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A072T5F9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A072THC0 |