Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2627485..2628527 | Replicon | chromosome |
Accession | NZ_CP104580 | ||
Organism | Stutzerimonas stutzeri strain GD04120 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | N5O82_RS12595 | Protein ID | WP_003153636.1 |
Coordinates | 2627952..2628527 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | N5O82_RS12590 | Protein ID | WP_003050245.1 |
Coordinates | 2627485..2627955 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O82_RS12555 (N5O82_12550) | 2622864..2624282 | - | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
N5O82_RS12560 (N5O82_12555) | 2624272..2625183 | - | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
N5O82_RS12565 (N5O82_12560) | 2625180..2625872 | - | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
N5O82_RS12570 (N5O82_12565) | 2625869..2626279 | - | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
N5O82_RS12575 (N5O82_12570) | 2626292..2626651 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
N5O82_RS12580 (N5O82_12575) | 2626668..2626901 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
N5O82_RS12585 (N5O82_12580) | 2626898..2627281 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
N5O82_RS12590 (N5O82_12585) | 2627485..2627955 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
N5O82_RS12595 (N5O82_12590) | 2627952..2628527 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
N5O82_RS12600 (N5O82_12595) | 2628545..2629459 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
N5O82_RS12605 (N5O82_12600) | 2629456..2629926 | + | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
N5O82_RS12610 (N5O82_12605) | 2629923..2630423 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
N5O82_RS12615 (N5O82_12610) | 2630423..2631325 | + | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
N5O82_RS12620 (N5O82_12615) | 2631364..2632089 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2562997..2681833 | 118836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T258460 WP_003153636.1 NZ_CP104580:2627952-2628527 [Stutzerimonas stutzeri]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT258460 WP_003050245.1 NZ_CP104580:2627485-2627955 [Stutzerimonas stutzeri]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|