Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelE-RHH |
Location | 3785348..3785916 | Replicon | chromosome |
Accession | NZ_CP104579 | ||
Organism | Pseudomonas oleovorans strain GD04132 |
Toxin (Protein)
Gene name | parE | Uniprot ID | W6QTT6 |
Locus tag | N5O83_RS18455 | Protein ID | WP_004424733.1 |
Coordinates | 3785635..3785916 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | W6RBZ2 |
Locus tag | N5O83_RS18450 | Protein ID | WP_004424730.1 |
Coordinates | 3785348..3785638 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O83_RS18420 (N5O83_18415) | 3780404..3781066 | - | 663 | WP_004424717.1 | type I-E CRISPR-associated protein Cas5/CasD | - |
N5O83_RS18425 (N5O83_18420) | 3781069..3782211 | - | 1143 | WP_004424719.1 | type I-E CRISPR-associated protein Cas7/Cse4/CasC | - |
N5O83_RS18430 (N5O83_18425) | 3782222..3782764 | - | 543 | WP_004424722.1 | type I-E CRISPR-associated protein Cse2/CasB | - |
N5O83_RS18435 (N5O83_18430) | 3782761..3784296 | - | 1536 | WP_004424723.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
N5O83_RS18440 (N5O83_18435) | 3784406..3784831 | - | 426 | WP_084340296.1 | type II toxin-antitoxin system VapC family toxin | - |
N5O83_RS18445 (N5O83_18440) | 3784831..3785082 | - | 252 | WP_004424728.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
N5O83_RS18450 (N5O83_18445) | 3785348..3785638 | + | 291 | WP_004424730.1 | hypothetical protein | Antitoxin |
N5O83_RS18455 (N5O83_18450) | 3785635..3785916 | + | 282 | WP_004424733.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
N5O83_RS18460 (N5O83_18455) | 3785919..3788576 | - | 2658 | WP_279533820.1 | CRISPR-associated helicase Cas3' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10565.07 Da Isoelectric Point: 8.6765
>T258457 WP_004424733.1 NZ_CP104579:3785635-3785916 [Pseudomonas oleovorans]
VKLAWTRLALNDRQAIRSYIAQDNPIATLALDELFTEKASRLADHPGLGRPGRVSGTRELVVHQHDLMIYDLVNDQVRIL
RVLHTARQWPSAD
VKLAWTRLALNDRQAIRSYIAQDNPIATLALDELFTEKASRLADHPGLGRPGRVSGTRELVVHQHDLMIYDLVNDQVRIL
RVLHTARQWPSAD
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|