Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/RHH(antitoxin)
Location 2093881..2094434 Replicon chromosome
Accession NZ_CP104579
Organism Pseudomonas oleovorans strain GD04132

Toxin (Protein)


Gene name parE Uniprot ID A0A385B7Q1
Locus tag N5O83_RS10180 Protein ID WP_003461247.1
Coordinates 2094141..2094434 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID W6RG82
Locus tag N5O83_RS10175 Protein ID WP_003461245.1
Coordinates 2093881..2094153 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O83_RS10145 (N5O83_10140) 2089206..2089379 + 174 WP_254472156.1 hypothetical protein -
N5O83_RS10150 (N5O83_10145) 2089449..2089730 - 282 WP_279534839.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5O83_RS10155 (N5O83_10150) 2089720..2089965 - 246 WP_132444928.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
N5O83_RS10160 (N5O83_10155) 2090154..2090852 - 699 WP_279534840.1 inovirus Gp2 family protein -
N5O83_RS10165 (N5O83_10160) 2091151..2092497 - 1347 WP_279534841.1 tyrosine-type recombinase/integrase -
N5O83_RS10170 (N5O83_10165) 2093218..2093547 + 330 Protein_2003 group II intron reverse transcriptase/maturase -
N5O83_RS10175 (N5O83_10170) 2093881..2094153 + 273 WP_003461245.1 CopG family ribbon-helix-helix protein Antitoxin
N5O83_RS10180 (N5O83_10175) 2094141..2094434 + 294 WP_003461247.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5O83_RS10185 (N5O83_10180) 2094428..2095102 - 675 Protein_2006 site-specific integrase -
N5O83_RS10190 (N5O83_10185) 2095130..2095480 + 351 WP_242408933.1 DUF262 domain-containing protein -
N5O83_RS10195 (N5O83_10190) 2095614..2096903 + 1290 WP_279534842.1 FAD-binding oxidoreductase -
N5O83_RS10200 (N5O83_10195) 2096920..2097477 + 558 WP_074914745.1 XRE family transcriptional regulator -
N5O83_RS10205 (N5O83_10200) 2097507..2098853 + 1347 WP_279534843.1 glutamine synthetase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2082873..2103910 21037


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-95)

Antitoxin

Ribbon-helix-helix protein, CopG

(3-40)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11183.67 Da        Isoelectric Point: 5.9081

>T258453 WP_003461247.1 NZ_CP104579:2094141-2094434 [Pseudomonas oleovorans]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRVAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY

Download         Length: 294 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10477.71 Da        Isoelectric Point: 6.7193

>AT258453 WP_003461245.1 NZ_CP104579:2093881-2094153 [Pseudomonas oleovorans]
MATSIKIDDKLKGRILQLASQRQRSSHWIMREAITQYVEREEARESFKQEALASWAAYQETGRHLTSQETRAWLGSWGTD
TEVELPKCHD

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A385B7Q1

Antitoxin

Source ID Structure
AlphaFold DB W6RG82

References