Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2089449..2089965 | Replicon | chromosome |
Accession | NZ_CP104579 | ||
Organism | Pseudomonas oleovorans strain GD04132 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N5O83_RS10150 | Protein ID | WP_279534839.1 |
Coordinates | 2089449..2089730 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5O83_RS10155 | Protein ID | WP_132444928.1 |
Coordinates | 2089720..2089965 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O83_RS10120 (N5O83_10115) | 2085210..2085539 | + | 330 | WP_279534837.1 | hypothetical protein | - |
N5O83_RS10125 (N5O83_10120) | 2085632..2086600 | + | 969 | WP_254472153.1 | DUF932 domain-containing protein | - |
N5O83_RS10130 (N5O83_10125) | 2086680..2087684 | + | 1005 | WP_254472212.1 | YqaJ viral recombinase family protein | - |
N5O83_RS10135 (N5O83_10130) | 2087776..2088726 | + | 951 | WP_279534838.1 | hydrolase or metal-binding protein | - |
N5O83_RS10140 (N5O83_10135) | 2088698..2089195 | + | 498 | WP_254472155.1 | DNA repair protein RadC | - |
N5O83_RS10145 (N5O83_10140) | 2089206..2089379 | + | 174 | WP_254472156.1 | hypothetical protein | - |
N5O83_RS10150 (N5O83_10145) | 2089449..2089730 | - | 282 | WP_279534839.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O83_RS10155 (N5O83_10150) | 2089720..2089965 | - | 246 | WP_132444928.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N5O83_RS10160 (N5O83_10155) | 2090154..2090852 | - | 699 | WP_279534840.1 | inovirus Gp2 family protein | - |
N5O83_RS10165 (N5O83_10160) | 2091151..2092497 | - | 1347 | WP_279534841.1 | tyrosine-type recombinase/integrase | - |
N5O83_RS10170 (N5O83_10165) | 2093218..2093547 | + | 330 | Protein_2003 | group II intron reverse transcriptase/maturase | - |
N5O83_RS10175 (N5O83_10170) | 2093881..2094153 | + | 273 | WP_003461245.1 | CopG family ribbon-helix-helix protein | - |
N5O83_RS10180 (N5O83_10175) | 2094141..2094434 | + | 294 | WP_003461247.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2082873..2103910 | 21037 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10742.59 Da Isoelectric Point: 10.6485
>T258452 WP_279534839.1 NZ_CP104579:c2089730-2089449 [Pseudomonas oleovorans]
MTYKLEFLPSALKEWEKLGHTVREQAKKKLGERLEAPKVQADALRDLPGHYKIKLRTASYRLVYRVEDDRVVVMVVAVGK
RERSTAYKAAGKR
MTYKLEFLPSALKEWEKLGHTVREQAKKKLGERLEAPKVQADALRDLPGHYKIKLRTASYRLVYRVEDDRVVVMVVAVGK
RERSTAYKAAGKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|