Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 747997..748538 | Replicon | chromosome |
Accession | NZ_CP104579 | ||
Organism | Pseudomonas oleovorans strain GD04132 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A379JU38 |
Locus tag | N5O83_RS03500 | Protein ID | WP_074856108.1 |
Coordinates | 747997..748293 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A379JUV6 |
Locus tag | N5O83_RS03505 | Protein ID | WP_074856106.1 |
Coordinates | 748281..748538 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O83_RS03480 (N5O83_03485) | 743995..745002 | + | 1008 | WP_279534397.1 | cytochrome d ubiquinol oxidase subunit II | - |
N5O83_RS03485 (N5O83_03490) | 745013..745159 | + | 147 | WP_279534398.1 | DUF2474 domain-containing protein | - |
N5O83_RS03490 (N5O83_03495) | 745232..746674 | + | 1443 | WP_279534399.1 | TldD/PmbA family protein | - |
N5O83_RS03495 (N5O83_03500) | 746674..747993 | + | 1320 | Protein_694 | metallopeptidase TldD-related protein | - |
N5O83_RS03500 (N5O83_03505) | 747997..748293 | - | 297 | WP_074856108.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O83_RS03505 (N5O83_03510) | 748281..748538 | - | 258 | WP_074856106.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N5O83_RS03510 (N5O83_03515) | 748608..749732 | - | 1125 | WP_004425056.1 | class I SAM-dependent methyltransferase | - |
N5O83_RS03515 (N5O83_03520) | 749976..750752 | + | 777 | WP_279534400.1 | ferredoxin--NADP reductase | - |
N5O83_RS03520 (N5O83_03525) | 750753..751778 | - | 1026 | WP_004425051.1 | hemolysin family protein | - |
N5O83_RS03525 (N5O83_03530) | 752019..752267 | + | 249 | WP_004425048.1 | YdcH family protein | - |
N5O83_RS03530 (N5O83_03535) | 752336..752614 | + | 279 | WP_279534401.1 | DUF465 domain-containing protein | - |
N5O83_RS03535 (N5O83_03540) | 752876..753352 | - | 477 | WP_279534402.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11418.23 Da Isoelectric Point: 6.0752
>T258448 WP_074856108.1 NZ_CP104579:c748293-747997 [Pseudomonas oleovorans]
MAEIVWTNTALEQLDDLAHYIALDKPDAARALVRRAVETVSRLADFPLSGRVPDELPHSVYREIVIPPCRIFYRYTDTTV
FIIHIMREERVLRAHMLE
MAEIVWTNTALEQLDDLAHYIALDKPDAARALVRRAVETVSRLADFPLSGRVPDELPHSVYREIVIPPCRIFYRYTDTTV
FIIHIMREERVLRAHMLE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A379JU38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A379JUV6 |