Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2882024..2882802 | Replicon | chromosome |
| Accession | NZ_CP104562 | ||
| Organism | Roseateles sp. BIM B-1768 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | N4261_RS12175 | Protein ID | WP_261760398.1 |
| Coordinates | 2882024..2882506 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | N4261_RS12180 | Protein ID | WP_261760399.1 |
| Coordinates | 2882533..2882802 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4261_RS12155 (N4261_12175) | 2877440..2878396 | - | 957 | WP_261760395.1 | xanthine dehydrogenase family protein subunit M | - |
| N4261_RS12160 (N4261_12180) | 2878393..2879040 | - | 648 | WP_261760694.1 | aldehyde dehydrogenase iron-sulfur subunit PaoA | - |
| N4261_RS12165 (N4261_12185) | 2879492..2879674 | - | 183 | WP_261760396.1 | DUF3606 domain-containing protein | - |
| N4261_RS12170 (N4261_12190) | 2879789..2881879 | - | 2091 | WP_261760397.1 | diguanylate cyclase | - |
| N4261_RS12175 (N4261_12195) | 2882024..2882506 | - | 483 | WP_261760398.1 | GNAT family N-acetyltransferase | Toxin |
| N4261_RS12180 (N4261_12200) | 2882533..2882802 | - | 270 | WP_261760399.1 | DUF1778 domain-containing protein | Antitoxin |
| N4261_RS12185 (N4261_12205) | 2883112..2884221 | + | 1110 | WP_261760400.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| N4261_RS12190 (N4261_12210) | 2884417..2886399 | - | 1983 | WP_261760401.1 | RecQ family ATP-dependent DNA helicase | - |
| N4261_RS12195 (N4261_12215) | 2886733..2886888 | + | 156 | WP_261760402.1 | DUF3309 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 16797.29 Da Isoelectric Point: 8.5093
>T258446 WP_261760398.1 NZ_CP104562:c2882506-2882024 [Roseateles sp. BIM B-1768]
MITAAHDCSAFTCTHTPLTDWLQRRALPNQAAGASRTYVVSTSDQQVVGYYALAPGAVAADATPGALRRNMPQPIPVFVL
GRLAVHSAWQGLGIGSGLLRDAVLRSAEAAQIVGGRALLCHSIDEQAKGFYCKHGFVQSPMEPLTVMLGLKASSTAPPNA
MITAAHDCSAFTCTHTPLTDWLQRRALPNQAAGASRTYVVSTSDQQVVGYYALAPGAVAADATPGALRRNMPQPIPVFVL
GRLAVHSAWQGLGIGSGLLRDAVLRSAEAAQIVGGRALLCHSIDEQAKGFYCKHGFVQSPMEPLTVMLGLKASSTAPPNA
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|