Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/- |
| Location | 75277..75857 | Replicon | chromosome |
| Accession | NZ_CP104562 | ||
| Organism | Roseateles sp. BIM B-1768 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N4261_RS00310 | Protein ID | WP_261758214.1 |
| Coordinates | 75480..75857 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N4261_RS00305 | Protein ID | WP_261758213.1 |
| Coordinates | 75277..75483 (+) | Length | 69 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4261_RS00285 (N4261_00285) | 70941..72290 | - | 1350 | WP_261760854.1 | pyridoxal-phosphate dependent enzyme | - |
| N4261_RS00290 (N4261_00290) | 72726..73556 | + | 831 | WP_261758210.1 | ABC transporter substrate-binding protein | - |
| N4261_RS00295 (N4261_00295) | 73720..74421 | + | 702 | WP_261758211.1 | amino acid ABC transporter permease | - |
| N4261_RS00300 (N4261_00300) | 74432..75112 | + | 681 | WP_261758212.1 | amino acid ABC transporter permease | - |
| N4261_RS00305 (N4261_00305) | 75277..75483 | + | 207 | WP_261758213.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N4261_RS00310 (N4261_00310) | 75480..75857 | + | 378 | WP_261758214.1 | PIN domain-containing protein | Toxin |
| N4261_RS00315 (N4261_00315) | 75877..76845 | - | 969 | WP_261758215.1 | ABC transporter permease subunit | - |
| N4261_RS00320 (N4261_00320) | 76842..77783 | - | 942 | WP_261758216.1 | ABC transporter ATP-binding protein | - |
| N4261_RS00325 (N4261_00325) | 77891..78853 | - | 963 | WP_261760855.1 | ABC transporter substrate-binding protein | - |
| N4261_RS00330 (N4261_00330) | 78898..79869 | - | 972 | WP_261758217.1 | TauD/TfdA family dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13769.29 Da Isoelectric Point: 7.2449
>T258445 WP_261758214.1 NZ_CP104562:75480-75857 [Roseateles sp. BIM B-1768]
MNIVVDTSVWIDFFRAGNDRLLHLLDADVVLAHPMIIGELACGTPRSPRTASLSMLRRLGLSRAVAMEEVLRLVEQEKLY
GKGCGLVDMVVLASTLKTPGAVLWSLDKRLTLLAEQFQIAMPSVH
MNIVVDTSVWIDFFRAGNDRLLHLLDADVVLAHPMIIGELACGTPRSPRTASLSMLRRLGLSRAVAMEEVLRLVEQEKLY
GKGCGLVDMVVLASTLKTPGAVLWSLDKRLTLLAEQFQIAMPSVH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|