Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2156460..2156989 | Replicon | chromosome |
Accession | NZ_CP104559 | ||
Organism | Staphylococcus aureus strain SA2107 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N4T05_RS10835 | Protein ID | WP_000621175.1 |
Coordinates | 2156460..2156822 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | N4T05_RS10840 | Protein ID | WP_000948331.1 |
Coordinates | 2156819..2156989 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T05_RS10815 (2153439) | 2153439..2154209 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
N4T05_RS10820 (2154184) | 2154184..2154663 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
N4T05_RS10825 (2154665) | 2154665..2154991 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
N4T05_RS10830 (2155110) | 2155110..2156111 | - | 1002 | WP_042744356.1 | PP2C family protein-serine/threonine phosphatase | - |
N4T05_RS10835 (2156460) | 2156460..2156822 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N4T05_RS10840 (2156819) | 2156819..2156989 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N4T05_RS10845 (2157074) | 2157074..2158222 | - | 1149 | WP_001281140.1 | alanine racemase | - |
N4T05_RS10850 (2158288) | 2158288..2158647 | - | 360 | WP_000581199.1 | holo-ACP synthase | - |
N4T05_RS10855 (2158651) | 2158651..2159142 | - | 492 | WP_001205907.1 | PH domain-containing protein | - |
N4T05_RS10860 (2159129) | 2159129..2160712 | - | 1584 | WP_001294637.1 | PH domain-containing protein | - |
N4T05_RS10865 (2160705) | 2160705..2161184 | - | 480 | WP_001287077.1 | hypothetical protein | - |
N4T05_RS10870 (2161392) | 2161392..2161952 | - | 561 | WP_001092406.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T258442 WP_000621175.1 NZ_CP104559:c2156822-2156460 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|