Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1903742..1904518 | Replicon | chromosome |
| Accession | NZ_CP104559 | ||
| Organism | Staphylococcus aureus strain SA2107 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | N4T05_RS09190 | Protein ID | WP_000031109.1 |
| Coordinates | 1903742..1903894 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | N4T05_RS09195 | Protein ID | WP_001251224.1 |
| Coordinates | 1903919..1904518 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T05_RS09175 (1899548) | 1899548..1900369 | + | 822 | WP_000669377.1 | RluA family pseudouridine synthase | - |
| N4T05_RS09180 (1900826) | 1900826..1902211 | - | 1386 | WP_000116239.1 | class II fumarate hydratase | - |
| N4T05_RS09185 (1902407) | 1902407..1902802 | - | 396 | WP_000901019.1 | hypothetical protein | - |
| N4T05_RS09190 (1903742) | 1903742..1903894 | - | 153 | WP_000031109.1 | SAS053 family protein | Toxin |
| N4T05_RS09195 (1903919) | 1903919..1904518 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| N4T05_RS09200 (1904677) | 1904677..1905147 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| N4T05_RS09205 (1905152) | 1905152..1906279 | - | 1128 | WP_261722546.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| N4T05_RS09210 (1906430) | 1906430..1907152 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| N4T05_RS09215 (1907145) | 1907145..1908602 | - | 1458 | WP_000649916.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5950.31 Da Isoelectric Point: 3.9075
>T258439 WP_000031109.1 NZ_CP104559:c1903894-1903742 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEESQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEESQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT258439 WP_001251224.1 NZ_CP104559:c1904518-1903919 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|