258438

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 868968..869445 Replicon chromosome
Accession NZ_CP104559
Organism Staphylococcus aureus strain SA2107

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag N4T05_RS04195 Protein ID WP_000052076.1
Coordinates 868968..869156 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag N4T05_RS04200 Protein ID WP_001059690.1
Coordinates 869185..869445 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T05_RS04165 (864958) 864958..865479 + 522 WP_000824479.1 hypothetical protein -
N4T05_RS04170 (865820) 865820..866506 + 687 WP_001622483.1 thermonuclease family protein -
N4T05_RS04175 (866863) 866863..867063 + 201 WP_001059082.1 cold-shock protein -
N4T05_RS04180 (867560) 867560..867778 - 219 WP_000005884.1 hypothetical protein -
N4T05_RS04185 (867851) 867851..868123 - 273 WP_001004400.1 hypothetical protein -
N4T05_RS04190 (868211) 868211..868780 - 570 WP_001106662.1 lipoprotein N-acylation protein LnsA -
N4T05_RS04195 (868968) 868968..869156 - 189 WP_000052076.1 hypothetical protein Toxin
N4T05_RS04200 (869185) 869185..869445 - 261 WP_001059690.1 hypothetical protein Antitoxin
N4T05_RS04205 (869786) 869786..869989 + 204 WP_000145160.1 sterile alpha motif-like domain-containing protein -
N4T05_RS04210 (869986) 869986..870222 - 237 WP_000368687.1 hypothetical protein -
N4T05_RS04215 (870446) 870446..871027 + 582 WP_001140696.1 histidine phosphatase family protein -
N4T05_RS04220 (871100) 871100..871717 - 618 WP_000255550.1 LysE/ArgO family amino acid transporter -
N4T05_RS04225 (871873) 871873..872367 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
N4T05_RS04230 (872766) 872766..873188 - 423 WP_000974451.1 organic hydroperoxide resistance protein -
N4T05_RS04235 (873336) 873336..874052 + 717 WP_000150033.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - sec / sell / vWbp 838274..879739 41465


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T258438 WP_000052076.1 NZ_CP104559:c869156-868968 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT258438 WP_001059690.1 NZ_CP104559:c869445-869185 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References