Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 840918..841447 | Replicon | chromosome |
Accession | NZ_CP104559 | ||
Organism | Staphylococcus aureus strain SA2107 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | K7ZRX6 |
Locus tag | N4T05_RS04035 | Protein ID | WP_001103939.1 |
Coordinates | 841130..841447 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | X5IY59 |
Locus tag | N4T05_RS04030 | Protein ID | WP_001058494.1 |
Coordinates | 840918..841127 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T05_RS03995 (837247) | 837247..837711 | + | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
N4T05_RS04005 (838274) | 838274..839380 | - | 1107 | WP_000149511.1 | tyrosine-type recombinase/integrase | - |
N4T05_RS04010 (839370) | 839370..840173 | - | 804 | WP_000358990.1 | helix-turn-helix transcriptional regulator | - |
N4T05_RS04015 (840310) | 840310..840513 | + | 204 | WP_001045296.1 | transcriptional regulator | - |
N4T05_RS04020 (840549) | 840549..840767 | + | 219 | WP_000163544.1 | helix-turn-helix transcriptional regulator | - |
N4T05_RS04025 (840779) | 840779..840925 | + | 147 | WP_000784885.1 | hypothetical protein | - |
N4T05_RS04030 (840918) | 840918..841127 | + | 210 | WP_001058494.1 | hypothetical protein | Antitoxin |
N4T05_RS04035 (841130) | 841130..841447 | + | 318 | WP_001103939.1 | DUF1474 family protein | Toxin |
N4T05_RS04040 (841511) | 841511..842380 | + | 870 | WP_001002717.1 | primase alpha helix C-terminal domain-containing protein | - |
N4T05_RS04045 (842397) | 842397..843854 | + | 1458 | WP_000390453.1 | virulence-associated E family protein | - |
N4T05_RS04050 (844155) | 844155..844517 | + | 363 | WP_001039170.1 | hypothetical protein | - |
N4T05_RS04055 (844519) | 844519..844803 | + | 285 | WP_000998185.1 | hypothetical protein | - |
N4T05_RS04060 (844800) | 844800..845441 | + | 642 | WP_001019808.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sec / sell / vWbp | 838274..879739 | 41465 | |
- | inside | Prophage | - | sec / sell | 838274..858383 | 20109 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12547.17 Da Isoelectric Point: 5.0161
>T258437 WP_001103939.1 NZ_CP104559:841130-841447 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|