Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
| Location | 5112579..5113177 | Replicon | chromosome |
| Accession | NZ_CP104557 | ||
| Organism | Pseudomonas promysalinigenes strain RL-WG26 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | N5C08_RS23695 | Protein ID | WP_186476156.1 |
| Coordinates | 5112875..5113177 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | N5C08_RS23690 | Protein ID | WP_261744407.1 |
| Coordinates | 5112579..5112878 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5C08_RS23670 (N5C08_23670) | 5108481..5108849 | - | 369 | WP_261744406.1 | hypothetical protein | - |
| N5C08_RS23675 (N5C08_23675) | 5109026..5109715 | + | 690 | WP_003253341.1 | phosphate regulon transcriptional regulator PhoB | - |
| N5C08_RS23680 (N5C08_23680) | 5109764..5111071 | + | 1308 | WP_060477252.1 | phosphate regulon sensor histidine kinase PhoR | - |
| N5C08_RS23685 (N5C08_23685) | 5111199..5112539 | + | 1341 | WP_060477253.1 | hemolysin family protein | - |
| N5C08_RS23690 (N5C08_23690) | 5112579..5112878 | - | 300 | WP_261744407.1 | putative addiction module antidote protein | Antitoxin |
| N5C08_RS23695 (N5C08_23695) | 5112875..5113177 | - | 303 | WP_186476156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5C08_RS23700 (N5C08_23700) | 5113219..5114121 | - | 903 | WP_261744408.1 | M23 family metallopeptidase | - |
| N5C08_RS23705 (N5C08_23705) | 5114236..5115135 | - | 900 | WP_060477257.1 | response regulator | - |
| N5C08_RS23710 (N5C08_23710) | 5115300..5116070 | - | 771 | WP_207936634.1 | phosphate signaling complex protein PhoU | - |
| N5C08_RS23715 (N5C08_23715) | 5116225..5117058 | - | 834 | WP_261744409.1 | phosphate ABC transporter ATP-binding protein PstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11351.89 Da Isoelectric Point: 10.3124
>T258435 WP_186476156.1 NZ_CP104557:c5113177-5112875 [Pseudomonas promysalinigenes]
MKSIKQTATYRNWERKLRDKQARAIIAARVFRLAHGLLGDVQPVGQGISELRIHHGPGYRIYYQQRGNQLVLLLCGGDKS
SQSRDIETAKSLASQWSDDE
MKSIKQTATYRNWERKLRDKQARAIIAARVFRLAHGLLGDVQPVGQGISELRIHHGPGYRIYYQQRGNQLVLLLCGGDKS
SQSRDIETAKSLASQWSDDE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|